PDB entry 3lff

View 3lff on RCSB PDB site
Description: Human p38 MAP Kinase in Complex with RL166
Class: transferase
Keywords: Thiazole-urea, DFG-out, SAR, ATP-binding, Kinase, Nucleotide-binding, Nucleus, Phosphoprotein, Serine/threonine-protein kinase, TRANSFERASE
Deposited on 2010-01-16, released 2011-04-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.2
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16539
      • engineered (118)
      • engineered (161)
      • engineered (326)
    Domains in SCOPe 2.06: d3lffa_
  • Heterogens: BOG, Z83, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lffA (A:)
    gsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfq
    siihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivksq
    kltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedselkildfglcrhtddemt
    gyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvg
    tpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaa
    qalahayfaqyhdpddepvadpydqslesrdllidewksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lffA (A:)
    rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivksqkltd
    dhvqfliyqilrglkyihsadiihrdlkpsnlavnedselkildfgatrwyrapeimlnw
    mhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarn
    yiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpdde
    pvadpydqslesrdllidewksltydevisfvppp