PDB entry 3lf0

View 3lf0 on RCSB PDB site
Description: Crystal structure of the ATP bound Mycobacterium tuberculosis nitrogen regulatory PII protein
Class: signaling protein/transcription
Keywords: PII protein, GlnK, GlnB, T-loop, 3-10 helix, C-loop, B-loop, Structural Genomics, TB Structural Genomics Consortium, TBSGC, Nucleotide-binding, Transcription, Transcription regulation, SIGNALING PROTEIN-TRANSCRIPTION complex
Deposited on 2010-01-15, released 2010-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-11, with a file datestamp of 2010-08-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.208
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogen regulatory protein p-II
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: glnB, MT2987, MTCY338.08c, Rv2919c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P64249 (2-113)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d3lf0a1, d3lf0a2
  • Chain 'B':
    Compound: nitrogen regulatory protein p-II
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: glnB, MT2987, MTCY338.08c, Rv2919c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P64249 (2-113)
      • expression tag (1)
    Domains in SCOPe 2.07: d3lf0b1, d3lf0b2
  • Chain 'C':
    Compound: nitrogen regulatory protein p-II
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: glnB, MT2987, MTCY338.08c, Rv2919c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P64249 (2-113)
      • expression tag (1)
    Domains in SCOPe 2.07: d3lf0c1, d3lf0c2
  • Heterogens: ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lf0A (A:)
    shmklitaivkpftlddvktsledagvlgmtvseiqgygrqkghtevyrgaeysvdfvpk
    vrievvvddsivdkvvdsivraartgkigdgkvwvspvdtivrvrtgerghdal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lf0A (A:)
    shmklitaivkpftlddvktsledagvlgmtvseiqgygrdfvpkvrievvvddsivdkv
    vdsivraartgkigdgkvwvspvdtivrvrtgerghdal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lf0B (B:)
    shmklitaivkpftlddvktsledagvlgmtvseiqgygrqkghtevyrgaeysvdfvpk
    vrievvvddsivdkvvdsivraartgkigdgkvwvspvdtivrvrtgerghdal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lf0B (B:)
    hmklitaivkpftlddvktsledagvlgmtvseiqgygrqghtevyrgaeysvdfvpkvr
    ievvvddsivdkvvdsivraartgkigdgkvwvspvdtivrvrtgerghdal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3lf0C (C:)
    shmklitaivkpftlddvktsledagvlgmtvseiqgygrqkghtevyrgaeysvdfvpk
    vrievvvddsivdkvvdsivraartgkigdgkvwvspvdtivrvrtgerghdal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lf0C (C:)
    hmklitaivkpftlddvktsledagvlgmtvseiqgygrysvdfvpkvrievvvddsivd
    kvvdsivraartgkigdgkvwvspvdtivrvrtgerghdal