PDB entry 3leu

View 3leu on RCSB PDB site
Description: high resolution 1h nmr study of leucocin a in dodecylphosphocholine micelles, 19 structures (1:40 ratio of leucocin a:dpc) (0.1% tfa)
Deposited on 1997-05-20, released 1997-11-26
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-04, with a file datestamp of 2003-11-04.
Experiment type: NMR19
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d3leu__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3leu_ (-)
    kyygngvhctksgcsvnwgeafsagvhrlanggngfw