PDB entry 3lel

View 3lel on RCSB PDB site
Description: Structural Insight into the Sequence-Dependence of Nucleosome Positioning
Class: structural protein/DNA
Keywords: nucleosome, nucleosome positioning, DNA flexibility, chromatin, Acetylation, Chromosomal protein, DNA-binding, Methylation, Nucleosome core, Nucleus, STRUCTURAL PROTEIN-DNA complex
Deposited on 2010-01-15, released 2010-05-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-05-19, with a file datestamp of 2010-05-14.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.231
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone H3.2
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84233 (Start-135)
      • see remark 999 (102)
    Domains in SCOPe 2.07: d3lela_
  • Chain 'B':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lelb_
  • Chain 'C':
    Compound: histone h2a
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lelc_
  • Chain 'D':
    Compound: Histone H2B 1.1
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02281 (Start-124)
      • see remark 999 (31)
    Domains in SCOPe 2.07: d3leld_
  • Chain 'E':
    Compound: Histone H3.2
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84233 (Start-135)
      • see remark 999 (102)
    Domains in SCOPe 2.07: d3lele_
  • Chain 'F':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lelf_
  • Chain 'G':
    Compound: histone h2a
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lelg_
  • Chain 'H':
    Compound: Histone H2B 1.1
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02281 (Start-124)
      • see remark 999 (31)
    Domains in SCOPe 2.07: d3lelh_
  • Chain 'I':
    Compound: 147-mer DNA
    Species: synthetic, synthetic
  • Chain 'J':
    Compound: 147-mer DNA
    Species: synthetic, synthetic
  • Chain 'K':
    Compound: Histone H3.2
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84233 (Start-135)
      • see remark 999 (102)
    Domains in SCOPe 2.07: d3lelk_
  • Chain 'L':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lell_
  • Chain 'M':
    Compound: histone h2a
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lelm_
  • Chain 'N':
    Compound: Histone H2B 1.1
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02281 (Start-124)
      • see remark 999 (31)
    Domains in SCOPe 2.07: d3leln_
  • Chain 'O':
    Compound: Histone H3.2
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84233 (Start-135)
      • see remark 999 (102)
    Domains in SCOPe 2.07: d3lelo_
  • Chain 'P':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lelp_
  • Chain 'Q':
    Compound: histone h2a
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lelq_
  • Chain 'R':
    Compound: Histone H2B 1.1
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02281 (Start-124)
      • see remark 999 (31)
    Domains in SCOPe 2.07: d3lelr_
  • Chain 'S':
    Compound: 147-mer DNA
    Species: synthetic, synthetic
  • Chain 'T':
    Compound: 147-mer DNA
    Species: synthetic, synthetic
  • Heterogens: MN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lelA (A:)
    martkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkste
    llirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvti
    mpkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lelA (A:)
    phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
    aylvalfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lelB (B:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lelB (B:)
    dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
    mdvvyalkrqgrtlygfgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3lelC (C:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    essksksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lelC (C:)
    ktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardnk
    ktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3lelD (D:)
    pepaksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskams
    imnsfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtk
    ytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lelD (D:)
    gkkrrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynk
    rstitsreiqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3lelE (E:)
    martkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkste
    llirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvti
    mpkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lelE (E:)
    phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
    aylvalfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3lelF (F:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lelF (F:)
    rhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyteha
    krktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3lelG (G:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    essksksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lelG (G:)
    kaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaard
    nkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkte
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3lelH (H:)
    pepaksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskams
    imnsfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtk
    ytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lelH (H:)
    rktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrsti
    tsreiqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3lelK (K:)
    martkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkste
    llirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvti
    mpkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lelK (K:)
    kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas
    eaylvalfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3lelL (L:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lelL (L:)
    dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
    mdvvyalkrqgrtlygfgg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3lelM (M:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    essksksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lelM (M:)
    ktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardnk
    ktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3lelN (N:)
    pepaksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskams
    imnsfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtk
    ytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lelN (N:)
    rktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrsti
    tsreiqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3lelO (O:)
    martkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkste
    llirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvti
    mpkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lelO (O:)
    phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
    aylvalfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3lelP (P:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lelP (P:)
    krhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyteh
    akrktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3lelQ (Q:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    essksksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lelQ (Q:)
    kaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaard
    nkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkte
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3lelR (R:)
    pepaksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskams
    imnsfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtk
    ytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lelR (R:)
    rktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrsti
    tsreiqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.