PDB entry 3ldv

View 3ldv on RCSB PDB site
Description: 1.77 Angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase from Vibrio cholerae O1 biovar eltor str. N16961
Class: lyase
Keywords: Orotidine 5'-Phosphate Decarboxylase, Structural Genomics, Infectious Diseases, Center for Structural Genomics of Infectious Diseases, Decarboxylase, Lyase, Pyrimidine biosynthesis, CSGID
Deposited on 2010-01-13, released 2010-01-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: pyrF, VC_1911
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KQT7 (24-End)
      • expression tag (23)
    Domains in SCOPe 2.07: d3ldva1, d3ldva2
  • Chain 'B':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: pyrF, VC_1911
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ldvb_
  • Heterogens: MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ldvA (A:)
    mhhhhhhssgvdlgtenlyfqsnamndpkvivaldydnladalafvdkidpstcrlkvgk
    emftlfgpdfvrelhkrgfsvfldlkfhdipntcskavkaaaelgvwmvnvhasggermm
    aasreilepygkerplligvtvltsmesadlqgigilsapqdhvlrlatltknagldgvv
    csaqeasllkqhlgrefklvtpgirpagseqgdqrrimtpaqaiasgsdylvigrpitqa
    ahpevvleeinsslv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ldvA (A:)
    amndpkvivaldydnladalafvdkidpstcrlkvgkemftlfgpdfvrelhkrgfsvfl
    dlkfhdipntcskavkaaaelgvwmvnvhasggermmaasreilepygkerplligvtvl
    tsmesadlqgigilsapqdhvlrlatltknagldgvvcsaqeasllkqhlgrefklvtpg
    irpagseqgdqrrimtpaqaiasgsdylvigrpitqaahpevvleeinssl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ldvB (B:)
    mhhhhhhssgvdlgtenlyfqsnamndpkvivaldydnladalafvdkidpstcrlkvgk
    emftlfgpdfvrelhkrgfsvfldlkfhdipntcskavkaaaelgvwmvnvhasggermm
    aasreilepygkerplligvtvltsmesadlqgigilsapqdhvlrlatltknagldgvv
    csaqeasllkqhlgrefklvtpgirpagseqgdqrrimtpaqaiasgsdylvigrpitqa
    ahpevvleeinsslv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ldvB (B:)
    ndpkvivaldydnladalafvdkidpstcrlkvgkemftlfgpdfvrelhkrgfsvfldl
    kfhdipntcskavkaaaelgvwmvnvhasggermmaasreilepygkerplligvtvlts
    mesadlqgigilsapqdhvlrlatltknagldgvvcsaqeasllkqhlgrefklvtpgir
    paqrrimtpaqaiasgsdylvigrpitqaahpevvleeinsslv