PDB entry 3ldq

View 3ldq on RCSB PDB site
Description: Crystal structure of HSC70/BAG1 in complex with small molecule inhibitor
Class: chaperone
Keywords: GRP78, HSP70, HSC70, CHAPERONE, HEAT SHOCK, PROTEIN FOLDING, ATP-BINDING, ADENOSINE, NUCLEOSIDE, NUCLEOTIDE-BINDING, STRESS RESPONSE, SMALL MOLECULE INHIBITOR, SELECTIVITY, Phosphoprotein, Apoptosis, Nucleus
Deposited on 2010-01-13, released 2011-01-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-29, with a file datestamp of 2011-06-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.206
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock cognate 71 kDa protein
    Species: Homo sapiens [TaxId:9606]
    Gene: HSPA8, HSC70, HSP73, HSPA10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ldqa1, d3ldqa2
  • Chain 'B':
    Compound: BAG family molecular chaperone regulator 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BAG1, HAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99933 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d3ldqb1, d3ldqb2
  • Heterogens: 3P1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ldqA (A:)
    yfqgpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqva
    mnptntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevs
    smvltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaa
    iaygldkkvgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnh
    fiaefkrkhkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitra
    rfeelnadlfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkeln
    ksinpdeavaygaavqaails
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ldqA (A:)
    pavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnpt
    ntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssmvl
    tkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaiayg
    ldkkvgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfiae
    fkrkhkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfee
    lnadlfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksin
    pdeavaygaavqaails
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ldqB (B:)
    gnspqeevelkklkhleksvekiadqleelnkeltgiqqgflpkdlqaealckldrrvka
    tieqfmkileeidtlilpenfkdsrlkrkglvkkvqaflaecdtveqnicqete
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ldqB (B:)
    gnspqeevelkklkhleksvekiadqleelnkeltgiqqgflpkdlqaealckldrrvka
    tieqfmkileeidtlilpenfkdsrlkrkglvkkvqaflaecdtveqnicq