PDB entry 3lda

View 3lda on RCSB PDB site
Description: Yeast Rad51 H352Y Filament Interface Mutant
Class: DNA binding protein
Keywords: DNA BINDING PROTEIN, ATP-binding, DNA damage, DNA recombination, DNA repair, Nucleotide-binding, non-prolyl cis peptide, ATP-hydrolysis, Walker A/B
Deposited on 2010-01-12, released 2010-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-22, with a file datestamp of 2010-09-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.2
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA repair protein rad51
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RAD51, YER095W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25454
      • engineered (351)
    Domains in SCOPe 2.07: d3ldaa1, d3ldaa2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ldaA (A:)
    msqvqeqhisesqlqygngslmstvpadlsqsvvdgngngssedieatngsgdggglqeq
    aeaqgemedeaydeaalgsfvpieklqvngitmadvkklresglhtaeavayaprkdlle
    ikgiseakadkllneaarlvpmgfvtaadfhmrrseliclttgsknldtllgggvetgsi
    telfgefrtgksqlchtlavtcqipldigggegkclyidtegtfrpvrlvsiaqrfgldp
    ddalnnvayaraynadhqlrlldaaaqmmsesrfslivvdsvmalyrtdfsgrgelsarq
    mhlakfmralqrladqfgvavvvtnqvvaqvdggmafnpdpkkpiggnimayssttrlgf
    kkgkgcqrlckvvdspclpeaecvfaiyedgvgdpreede
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ldaA (A:)
    gsfvpieklqvngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaa
    rlvpmgfvtaadfhmrrseliclttgsknldtllgggvetgsitelfgefrtgksqlcht
    lavtcqipldigggegkclyidtegtfrpvrlvsiaqrfgldpddalnnvayaraynadh
    qlrlldaaaqmmsesrfslivvdsvmalyrgelsarqmhlakfmralqrladqfgvavvv
    tnqvnimayssttrlgfkkgkgcqrlckvvdspclpeaecvfaiyedgvgdpr