PDB entry 3ld8

View 3ld8 on RCSB PDB site
Description: Structure of JMJD6 and Fab Fragments
Class: immune system
Keywords: JMJD6, Fab Fragments, IMMUNE SYSTEM
Deposited on 2010-01-12, released 2010-08-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-06-20, with a file datestamp of 2012-06-15.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.233
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6
    Species: Homo sapiens [TaxId:9606]
    Gene: JMJD6, JMJD6(1-403), KIAA0585, PTDSR
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: antibody fab fragment light chain
    Species: Cricetulus migratorius [TaxId:10032]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LD8 (0-End)
    Domains in SCOPe 2.04: d3ld8b1, d3ld8b2
  • Chain 'C':
    Compound: antibody fab fragment heavy chain
    Species: Cricetulus migratorius [TaxId:10032]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LD8 (0-End)
  • Heterogens: HG, GOL, SO4, FE

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ld8B (B:)
    divmtqspsslavsagekvtmscrssqslyysgikknllawyqlkpgqspklliyyastl
    ftgvpdrftgsgsgtdytltitsvqaedmgqyfcqqgisnpytfgagtkleikradakpt
    vsifppsseqlgtgsatlvcfvnnfypkdinvkwkvdgsekrdgvlqsvtdqdskdstys
    lsstlsltkadyerhnlytcevthktstaaivktlnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ld8B (B:)
    divmtqspsslavsagekvtmscrssqslyysgikknllawyqlkpgqspklliyyastl
    ftgvpdrftgsgsgtdytltitsvqaedmgqyfcqqgisnpytfgagtkleikradakpt
    vsifppsseqlgtgsatlvcfvnnfypkdinvkwkvdgsekrdgvlqsvtdqdskdstys
    lsstlsltkadyerhnlytcevthktstaaivktlnr
    

  • Chain 'C':
    No sequence available.