PDB entry 3lck

View 3lck on RCSB PDB site
Description: the kinase domain of human lymphocyte kinase (lck), activated form (auto-phosphorylated on tyr394)
Class: tyrosine-protein kinase
Keywords: tyrosine-protein kinase, ATP-binding, phosphorylation, signal transduction
Deposited on 1997-04-08, released 1997-12-03
The last revision prior to the SCOP 1.75 freeze date was dated 1997-12-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.178
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proto-oncogene tyrosine-protein kinase
    Species: HOMO SAPIENS
    Gene: LCK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06239 (0-270)
      • conflict (163)
    Domains in SCOP 1.75: d3lcka_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lckA (A:)
kpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaean
lmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiae
gmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtape
ainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeely
qlmrlcwkerpedrptfdylrsvledfftat