PDB entry 3lcj

View 3lcj on RCSB PDB site
Description: Phosphopantetheine adenylyltransferase from Mycobacterium tuberculosis complexed with CoA
Class: transferase
Keywords: ppat, ATP-binding, Coenzyme A biosynthesis, Nucleotide-binding, Nucleotidyltransferase, TRANSFERASE
Deposited on 2010-01-11, released 2010-07-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.229
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphopantetheine adenylyltransferase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: coaD, kdtB, Rv2965c, MT3043, MTCY349.22, u0002e
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lcja_
  • Heterogens: COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lcjA (A:)
    mtgavcpgsfdpvtlghvdiferaaaqfdevvvailvnpaktgmfdlderiamvkestth
    lpnlrvqvghglvvdfvrscgmtaivkglrtgtdfeyelqmaqmnkhiagvdtffvatap
    rysfvssslakevamlggdvsellpepvnrrlrdrlntert
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lcjA (A:)
    mtgavcpgsfdpvtlghvdiferaaaqfdevvvailvnpaktgmfdlderiamvkestth
    lpnlrvqvghglvvdfvrscgmtaivkglrtgtdfeyelqmaqmnkhiagvdtffvatap
    rysfvssslakevamlggdvsellpepvnrrlrdrln