PDB entry 3lc5

View 3lc5 on RCSB PDB site
Description: Selective Benzothiophine Inhibitors of Factor IXa
Class: Hydrolase/Hydrolase Inhibitor
Keywords: Protein-Inhibitor complex, Peptidase S1, Blood coagulation, Calcium, Cleavage on pair of basic residues, Disease mutation, Disulfide bond, EGF-like domain, Gamma-carboxyglutamic acid, Glycoprotein, Hemophilia, Hydrolase, Hydroxylation, Pharmaceutical, Phosphoprotein, Polymorphism, Protease, Secreted, Serine protease, Sulfation, Zymogen, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2010-01-09, released 2010-02-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-03-02, with a file datestamp of 2010-02-26.
Experiment type: XRAY
Resolution: 2.62 Å
R-factor: 0.213
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: coagulation factor ix
  Species: Homo sapiens [TaxId:9606]
  Gene: F9
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00740 (0-234)
  Domains in SCOPe 2.01: d3lc5a_
• Chain 'B':
  Compound: coagulation factor ix
  Species: Homo sapiens [TaxId:9606]
  Gene: F9
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00740 (1-End)
    • initiating methionine (0)
  Domains in SCOPe 2.01: d3lc5b_
• Heterogens: CA, IZX, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3lc5A (A:)
  vvggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee
  tehteqkrnviriiphhnynaainkynhdialleldeplvlnsyvtpiciadkeytnifl
  kfgsgyvsgwgrvfhkgrsalvlqylrvplvdratclrstkftiynnmfcagfheggrds
  cqgdsggphvtevegtsfltgiiswgeecamkgkygiytkvsryvnwikektklt
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >3lc5B (B:)
  mtcnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsvsqtsk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3lc5B (B:)
  mtcnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsvsq