PDB entry 3lbk

View 3lbk on RCSB PDB site
Description: Structure of human MDM2 protein in complex with a small molecule inhibitor
Class: ligase
Keywords: MDMX, MDM2, p53, inhibitor, Alternative splicing, Cytoplasm, Ligase, Nucleus, Phosphoprotein, Proto-oncogene, Ubl conjugation, Ubl conjugation pathway, Zinc-finger
Deposited on 2010-01-08, released 2010-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987
      • engineered (16)
    Domains in SCOPe 2.07: d3lbka_
  • Heterogens: K23, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lbkA (A:)
    mqipaseqetlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivy
    csndllgdlfgvpsfsvkehrkiytmiyrnlvvvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lbkA (A:)
    tlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgdl
    fgvpsfsvkehrkiytmiyrnlvvv