PDB entry 3lb8

View 3lb8 on RCSB PDB site
Description: Crystal structure of the covalent putidaredoxin reductase-putidaredoxin complex
Class: Oxidoreductase/Electron Transport
Keywords: covalently linked protein-protein complex, FAD, Flavoprotein, Oxidoreductase, 2Fe-2S, Electron transport, Iron-sulfur, Metal-binding, Oxidoreductase-Electron Transport complex
Deposited on 2010-01-07, released 2010-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-05-19, with a file datestamp of 2010-05-14.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.244
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putidaredoxin reductase
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Putidaredoxin reductase
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMA
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: putidaredoxin
    Species: Pseudomonas putida [TaxId:303]
    Gene: camA, camB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00259 (0-End)
      • engineered (72)
      • engineered (84)
    Domains in SCOPe 2.07: d3lb8c_
  • Chain 'D':
    Compound: putidaredoxin
    Species: Pseudomonas putida [TaxId:303]
    Gene: camA, camB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00259 (0-End)
      • engineered (72)
      • engineered (84)
    Domains in SCOPe 2.07: d3lb8d_
  • Heterogens: FAD, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3lb8C (C:)
    skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
    paanereigmlesvtaelkpnsrlscqiimtpeldgivvdvpdrqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lb8C (C:)
    skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
    paanereigmlesvtaelkpnsrlscqiimtpeldgivvdvpdr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3lb8D (D:)
    skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
    paanereigmlesvtaelkpnsrlscqiimtpeldgivvdvpdrqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lb8D (D:)
    skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
    paanereigmlesvtaelkpnsrlscqiimtpeldgivvdvpd