PDB entry 3lau

View 3lau on RCSB PDB site
Description: Crystal Structure of Aurora2 kinase in complex with a GSK3beta inhibitor
Class: Transferase
Keywords: Kinase inhibitor complex, ATP-binding, Cell cycle, Cytoplasm, Cytoskeleton, Kinase, Nucleotide-binding, Phosphoprotein, Polymorphism, Serine/threonine-protein kinase, Transferase, Ubl conjugation
Deposited on 2010-01-07, released 2010-03-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-04-07, with a file datestamp of 2010-04-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.203
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: AIK, ARK1, AURA, AURKA, BTAK, STK15, STK6
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14965 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.06: d3laua1, d3laua2
  • Heterogens: OFI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lauA (A:)
    mkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreve
    iqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelana
    lsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrtdlcgtldylppemieg
    rmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrl
    lkhnpsqrpmlrevlehpwitansskpsncqnkesaaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lauA (A:)
    mkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreve
    iqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelana
    lsychskrvihrdikpenlllgsagelkiadfldylppemiegrmhdekvdlwslgvlcy
    eflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevleh
    pwitansskps