PDB entry 3l9s

View 3l9s on RCSB PDB site
Description: Crystal Structure of Salmonella enterica serovar Typhimurium DsbA
Class: oxidoreductase
Keywords: thioredoxin-fold, DsbA, thiol-disulfide oxidoreductase, Disulfide bond, Redox-active center, OXIDOREDUCTASE
Deposited on 2010-01-05, released 2010-03-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.147
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thiol:disulfide interchange protein
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:216597]
    Gene: dsbA, STM3997
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3l9sa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l9sA (A:)
    snaaqisdgkqyitldkpvagepqvleffsfycphcyqfeevlhvsdnvkkklpegtkmt
    kyhveflgplgkeltqawavamalgvedkvtvplfeavqktqtvqsaadirkvfvdagvk
    gedydaawnsfvvkslvaqqekaaadlqlqgvpamfvngkyqinpqgmdtssmdvfvqqy
    adtvkylvdkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l9sA (A:)
    isdgkqyitldkpvagepqvleffsfycphcyqfeevlhvsdnvkkklpegtkmtkyhve
    flgplgkeltqawavamalgvedkvtvplfeavqktqtvqsaadirkvfvdagvkgedyd
    aawnsfvvkslvaqqekaaadlqlqgvpamfvngkyqinpqgmdtssmdvfvqqyadtvk
    ylvdk