PDB entry 3l9k

View 3l9k on RCSB PDB site
Description: Insights into dynein assembly from a dynein intermediate chain-light chain roadblock structure
Class: motor protein
Keywords: dynein, intermediate chain, IC, LC7, light chain 7, km23, roadblock, Hydrolase, Lysosome, Membrane, Microtubule, Motor protein, Nucleus, WD repeat
Deposited on 2010-01-05, released 2010-05-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.228
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RE64145p
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: robl, CG10751, Dmel_CG10751
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3l9ka_
  • Chain 'B':
    Compound: RE64145p
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: robl, CG10751, Dmel_CG10751
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3l9kb_
  • Chain 'C':
    Compound: RE64145p
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: robl, CG10751, Dmel_CG10751
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3l9kc_
  • Chain 'D':
    Compound: RE64145p
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: robl, CG10751, Dmel_CG10751
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3l9kd_
  • Chain 'W':
    Compound: Dynein intermediate chain, cytosolic
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: sw, Cdic, Dic19B, CG18000
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: Dynein intermediate chain, cytosolic
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: sw, Cdic, Dic19B, CG18000
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: Dynein intermediate chain, cytosolic
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: sw, Cdic, Dic19B, CG18000
    Database cross-references and differences (RAF-indexed):
  • Chain 'Z':
    Compound: Dynein intermediate chain, cytosolic
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: sw, Cdic, Dic19B, CG18000
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3l9kA (A:)
msqeveetlkriqshkgvvgtivvnnegipvkstldntttvqyaglmsqladkarsvvrd
ldpsndmtflrvrskkheimvapdkdfiliviqnptd

    Sequence, based on observed residues (ATOM records): (download) 
    >3l9kA (A:)
qeveetlkriqshkgvvgtivvnnegipvkstldntttvqyaglmsqladkarsvvrdld
psndmtflrvrskkheimvapdkdfiliviqnptd

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3l9kB (B:)
msqeveetlkriqshkgvvgtivvnnegipvkstldntttvqyaglmsqladkarsvvrd
ldpsndmtflrvrskkheimvapdkdfiliviqnptd

    Sequence, based on observed residues (ATOM records): (download) 
    >3l9kB (B:)
qeveetlkriqshkgvvgtivvnnegipvkstldntttvqyaglmsqladkarsvvrdld
psndmtflrvrskkheimvapdkdfiliviqnptd

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >3l9kC (C:)
msqeveetlkriqshkgvvgtivvnnegipvkstldntttvqyaglmsqladkarsvvrd
ldpsndmtflrvrskkheimvapdkdfiliviqnptd

    Sequence, based on observed residues (ATOM records): (download) 
    >3l9kC (C:)
qeveetlkriqshkgvvgtivvnnegipvkstldntttvqyaglmsqladkarsvvrdld
psndmtflrvrskkheimvapdkdfiliviqnptd

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >3l9kD (D:)
msqeveetlkriqshkgvvgtivvnnegipvkstldntttvqyaglmsqladkarsvvrd
ldpsndmtflrvrskkheimvapdkdfiliviqnptd

    Sequence, based on observed residues (ATOM records): (download) 
    >3l9kD (D:)
qeveetlkriqshkgvvgtivvnnegipvkstldntttvqyaglmsqladkarsvvrdld
psndmtflrvrskkheimvapdkdfiliviqnptd

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.