PDB entry 3l9i

View 3l9i on RCSB PDB site
Description: Myosin VI nucleotide-free (mdinsert2) L310G mutant crystal structure
Class: motor protein
Keywords: myosin VI, unconventional myosin, directionality, motility, gating, Actin-binding, ATP-binding, Calmodulin-binding, Endocytosis, Golgi apparatus, Hearing, Membrane, Motor protein, Myosin, Nucleotide-binding, Nucleus, Phosphoprotein, Protein transport, Transport
Deposited on 2010-01-05, released 2010-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.187
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin-VI
    Species: Sus scrofa [TaxId:9823]
    Gene: MYO6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q29122
      • engineered (308)
      • see remark 999 (545)
      • see remark 999 (570-571)
      • see remark 999 (712)
      • see remark 999 (719-720)
  • Chain 'C':
    Compound: calmodulin
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Cam, CG8472
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l9ic_
  • Heterogens: TBU, ACT, PO4, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3l9iC (C:)
    madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadg
    ngtidfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltde
    evdemireadidgdgqvnyeefvtmmtsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l9iC (C:)
    qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
    idfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevd
    emireadidgdgqvnyeefvtmmts