PDB entry 3l9d

View 3l9d on RCSB PDB site
Description: The Crystal Structure of smu.1046c from Streptococcus mutans UA159
Class: transferase
Keywords: GTP pyrophosphokinase, Kinase, TRANSFERASE
Deposited on 2010-01-05, released 2011-01-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative GTP pyrophosphokinase
    Species: Streptococcus mutans [TaxId:210007]
    Gene: smu.1046c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3l9da_
  • Chain 'B':
    Compound: Putative GTP pyrophosphokinase
    Species: Streptococcus mutans [TaxId:210007]
    Gene: smu.1046c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3l9db_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l9dA (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsmnweefldpyiqavgelkikfrgirk
    qfrkqkrhspiefvtgrvkpiesikekmvlrgikkenltqdmqdiaglrimvqfvddvnd
    vlellrqrkdmkviqerdyinnlkpsgyrsyhviveypvdtisgqriimaeiqirtlamn
    fwatiehslnykyhgefpedikrrleltskiafqldeemrqirddikeaqllfdaetrkl
    ndgvgnsddtdelyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l9dA (A:)
    mnweefldpyiqavgelkikfrgirkqfrkqkrhspiefvtgrvkpiesikekmvlrgik
    kenltqdmqdiaglrimvqfvddvndvlellrqrkdmkviqerdyinnkpsgyrsyhviv
    eypvdtisgqriimaeiqirtlamnfwatiehslnykyhgefpedikrrleltskiafql
    deemrqirddikeaqllf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3l9dB (B:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsmnweefldpyiqavgelkikfrgirk
    qfrkqkrhspiefvtgrvkpiesikekmvlrgikkenltqdmqdiaglrimvqfvddvnd
    vlellrqrkdmkviqerdyinnlkpsgyrsyhviveypvdtisgqriimaeiqirtlamn
    fwatiehslnykyhgefpedikrrleltskiafqldeemrqirddikeaqllfdaetrkl
    ndgvgnsddtdelyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l9dB (B:)
    eefldpyiqavgelkikfrgirkqfrkqkrhspiefvtgrvkpiesikekmvlrgikken
    ltqdmqdiaglrimvqfvddvndvlellrqrkdmkviqerdyinnsgyrsyhviveypvd
    tisgqriimaeiqirtlamnfwatiehslnykyhgefpedikrrleltskiafqldeemr
    qirddikeaqllf