PDB entry 3l99

View 3l99 on RCSB PDB site
Description: Structural determination of the A50T:S279G:S280K:V281K:K282E:H283N Variant of Citrate Synthase from E. coli complexed with oxaloacetate
Class: transferase
Keywords: Citrate Synthase, quaternary, hexamer, Gram-negative bacteria, allostery, oxaloacetate, Acetyl-CoA, NADH, Protein Folding, S-carboxymethyl-CoA, Allosteric enzyme, Transferase, Tricarboxylic acid cycle
Deposited on 2010-01-04, released 2011-02-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-17, with a file datestamp of 2013-07-12.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.182
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: citrate synthase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABH7
      • variant (49)
      • variant (278-282)
    Domains in SCOPe 2.06: d3l99a_
  • Chain 'B':
    Compound: citrate synthase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABH7 (0-425)
      • variant (49)
      • variant (278-282)
    Domains in SCOPe 2.06: d3l99b_
  • Heterogens: OAA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l99A (A:)
    adtkakltlngdtaveldvlkgtlgqdvidirtlgskgvftfdpgftsttsceskitfid
    gdegillhrgfpidqlatdsnylevcyillngekptqeqydefkttvtrhtmiheqitrl
    fhafrrdshpmavmcgitgalaafyhdsldvnnprhreiaafrllskmptmaamcykysi
    gqpfvyprndlsyagnflnmmfstpcepyevnpileramdrililhadheqnaststvrt
    agssganpfaciaagiaslwgpahgganeaalkmleeigkkenipefvrrakdkndsfrl
    mgfghrvyknydpratvmretchevlkelgtkddllevamelenialndpyfiekklypn
    vdfysgiilkamgipssmftvifamartvgwiahwsemhsdgmkiarprqlytgyekrdf
    ksdikr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l99B (B:)
    adtkakltlngdtaveldvlkgtlgqdvidirtlgskgvftfdpgftsttsceskitfid
    gdegillhrgfpidqlatdsnylevcyillngekptqeqydefkttvtrhtmiheqitrl
    fhafrrdshpmavmcgitgalaafyhdsldvnnprhreiaafrllskmptmaamcykysi
    gqpfvyprndlsyagnflnmmfstpcepyevnpileramdrililhadheqnaststvrt
    agssganpfaciaagiaslwgpahgganeaalkmleeigkkenipefvrrakdkndsfrl
    mgfghrvyknydpratvmretchevlkelgtkddllevamelenialndpyfiekklypn
    vdfysgiilkamgipssmftvifamartvgwiahwsemhsdgmkiarprqlytgyekrdf
    ksdikr