PDB entry 3l92

View 3l92 on RCSB PDB site
Description: Phosphopantetheine adenylyltransferase from Yersinia pestis complexed with coenzyme A.
Class: transferase
Keywords: structural genomics, phosphopantetheine adenylyltransferase, coenzyme A, ATP-binding, Coenzyme A biosynthesis, Nucleotide-binding, Nucleotidyltransferase, Transferase, Center for Structural Genomics of Infectious Diseases, CSGID
Deposited on 2010-01-04, released 2010-01-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.165
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phosphopantetheine adenylyltransferase
  Species: Yersinia pestis [TaxId:214092]
  Gene: coaD, kdtB, y0088, YPO0053, YP_0054
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8ZJN9 (3-161)
  Domains in SCOPe 2.04: d3l92a_
• Heterogens: COA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3l92A (A:)
  snamitkaiypgtfdpitnghldlvtrasamfshvilaiadssskkpmftldervalakk
  vtaplknvevlgfselmaefakkhnanilvrglrsvsdfeyewqlanmnrhlmpklesvf
  lipsekwsfissslvkevarhggditpflpkpvtkallakla
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3l92A (A:)
  mitkaiypgtfdpitnghldlvtrasamfshvilaiadssskkpmftldervalakkvta
  plknvevlgfselmaefakkhnanilvrglrsvsdfeyewqlanmnrhlmpklesvflip
  sekwsfissslvkevarhggditpflpkpvtkallakla