PDB entry 3l8x

View 3l8x on RCSB PDB site
Description: P38 alpha kinase complexed with a pyrazolo-pyrimidine based inhibitor
Class: transferase
Keywords: p38 map kinase, serine/threonine-protine kinase, transferase
Deposited on 2010-01-04, released 2010-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-03-02, with a file datestamp of 2010-02-26.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.225
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: CSBP, CSBP1, CSBP2, CSPB1, MAPK14, MXI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l8xa_
  • Heterogens: N4D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l8xA (A:)
    mahhhhhsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkk
    lsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadln
    nivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarh
    tddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlkl
    ilrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsd
    kritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld
    qeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l8xA (A:)
    erptfyrqelnktiwevperyqnlspvsvcaafdtktglrvavkklsrpfqsiihakrty
    relrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkqkltddhvqfl
    iyqilrglkyihsadiihrdlkpsnlavnedcelkildfglaratrwyrapeimnqtvdi
    wsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsltqmp
    kmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadpydqs
    fesrdllidewksltydevisfvppp