PDB entry 3l8v

View 3l8v on RCSB PDB site
Description: Crystal structure of the tyrosine kinase domain of the hepatocyte growth factor receptor C-MET in complex with a biarylamine based inhibitor
Class: transferase
Keywords: RECEPTOR TYROSINE KINASE, SIGNAL TRANSDUCTION, GRB2, SHC, ATP-BINDING, GLYCOPROTEIN, MEMBRANE, NUCLEOTIDE-BINDING, PHOSPHOPROTEIN, PROTO-ONCOGENE, TRANSFERASE, TRANSMEMBRANE, TYROSINE-PROTEIN KINASE, Alternative splicing, Chromosomal rearrangement, Disease mutation, Disulfide bond, Kinase, Polymorphism, Receptor
Deposited on 2010-01-04, released 2010-05-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-05-05, with a file datestamp of 2010-04-30.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.185
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581 (Start-313)
      • engineered (147)
    Domains in SCOPe 2.06: d3l8va_
  • Heterogens: L8V, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l8vA (A:)
    gantvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkih
    cavkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlr
    nfirnethnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfgla
    rdmydkefdsvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypd
    vntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig
    ehyvhvnatyvnvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l8vA (A:)
    dlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavksln
    ritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnet
    hnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfgnktgaklpv
    kwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqgrrllqpey
    cpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehyvhvnatyvnvk