PDB entry 3l8p

View 3l8p on RCSB PDB site
Description: Crystal structure of cytoplasmic kinase domain of Tie2 complexed with inhibitor CEP11207
Class: transferase
Keywords: receptor tyrosine kinase, cytoplasmic kinase domain, Tie2, inhibitor CEP11207, ATP-binding, Disease mutation, Glycoprotein, Kinase, Membrane, Nucleotide-binding, Phosphoprotein, Receptor, Transferase, Tyrosine-protein kinase
Deposited on 2010-01-03, released 2010-10-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-10-06, with a file datestamp of 2010-10-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.238
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Angiopoietin-1 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: TEK, TIE2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3l8pa_
  • Heterogens: 0CE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l8pA (A:)
    knnpdptiypvldwndikfqdvigegnfgqvlkarikkdglrmdaaikrmkeyaskddhr
    dfagelevlcklghhpniinllgacehrgylylaieyaphgnlldflrksrvletdpafa
    ianstastlssqqllhfaadvargmdylsqkqfihrdlaarnilvgenyvakiadfglsr
    gqevyvkktmgrlpvrwmaieslnysvyttnsdvwsygvllweivslggtpycgmtcael
    yeklpqgyrlekplncddevydlmrqcwrekpyerpsfaqilvslnrmleerktyvnttl
    yekftyagidcsaeeaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l8pA (A:)
    tiypvldwndikfqdvigegnfgqvlkarikkdglrmdaaikrmfagelevlcklghhpn
    iinllgacehrgylylaieyaphgnlldflrksrvletdpafaianstastlssqqllhf
    aadvargmdylsqkqfihrdlaarnilvgenyvakiadfglsrgqevyvkkpvrwmaies
    lnysvyttnsdvwsygvllweivslggtpycgmtcaelyeklpqgyrlekplncddevyd
    lmrqcwrekpyerpsfaqilvslnrmleerktyvnttlyekftyagidcsae