PDB entry 3l8n

View 3l8n on RCSB PDB site
Description: Crystal Structure of a domain of Brefeldin A-inhibited guanine nucleotide-exchange protein 2 (BrefeldinA-inhibited GEP 2) from Homo sapiens (Human). Northeast Structural Genomics Consortium target id HR5562A
Class: Nucleotide-binding protein, Metal-binding protein
Keywords: Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Guanine-nucleotide releasing factor, Phosphoprotein, Nucleotide-binding protein, Metal-binding protein
Deposited on 2009-12-31, released 2010-04-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-04-07, with a file datestamp of 2010-04-02.
Experiment type: XRAY
Resolution: 2.86 Å
R-factor: 0.236
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Brefeldin A-inhibited guanine nucleotide-exchange protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ARFGEF2, ARFGEP2, BIG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l8na_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l8nA (A:)
    eqfevikqqkeiiehgielfnkkpkrgiqflqeqgmlgtsvediaqflhqeerldstqvg
    dflgdsarfnkevmyayvdqldfcekefvsalrtflegfrlpgeaqkidrlmekfaaryi
    ecnqgqtlfasadtayvlaysiimlttdlhspqvknkmtkeqyikmnrgindskdlpeey
    lssiyeeiegkkiamketkelt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l8nA (A:)
    ikqqkeiiehgielfnkkpkrgiqflqeqgmlgtsvediaqflhqeerldstqvgdflgd
    sarfnkevmyayvdqlekefvsalrtflegfrlpgeaqkidrlmekfaaryieclfasad
    tayvlaysiimlttdlpqvknkmtkeqyikmnrgindskdlpeeylssiyeeiegkkia