PDB entry 3l8a

View 3l8a on RCSB PDB site
Description: Crystal structure of MetC from Streptococcus mutans
Class: lyase
Keywords: MetC, smu.1674, beta-cystathionase, Streptococcus mutans, Aminotransferase, Lyase, Transferase
Deposited on 2009-12-30, released 2011-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative aminotransferase, probable beta-cystathionase
    Species: Streptococcus mutans [TaxId:210007]
    Gene: SMU_1674
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l8aa_
  • Chain 'B':
    Compound: Putative aminotransferase, probable beta-cystathionase
    Species: Streptococcus mutans [TaxId:210007]
    Gene: SMU_1674
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l8ab_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l8aA (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsmgrydfttrpdrlnqftykwktsenn
    pellqmwvadmdflpvpeikeaiinygrehifgynyfnddlyqavidwerkehdyavvke
    dilfidgvvpaisialqafsekgdavlinspvyypfartirlndhrlvenslqiingrfe
    idfeqlekdiidnnvkiyllcsphnpggrvwdnddlikiaelckkhgvilvsdeihqdla
    lfgnthhslntldasykdftiilssatktfniagtknsfaiiqneslrrkfqyrqlannq
    hevptvgmiatqaafqygkpwleelktviegniklvikeleaktkikvmepegtylvwld
    fsayaiaqpqlseklqneakvvlndgahfgkegkyfarlnvatpkntvqealsriisvfg
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l8aA (A:)
    ydfttrpdrlnqftykwktsennpellqmwvadmdflpvpeikeaiinygrehifgynyf
    nddlyqavidwerkehdyavvkedilfidgvvpaisialqafsekgdavlinspvyypfa
    rtirlndhrlvenslqiingrfeidfeqlekdiidnnvkiyllcsphnpggrvwdnddli
    kiaelckkhgvilvsdeihqdlalfgnthhslntldasykdftiilssatktfniagtkn
    sfaiiqneslrrkfqyrqlannqhevptvgmiatqaafqygkpwleelktviegniklvi
    keleaktkikvmepegtylvwldfsayaiaqpqlseklqneakvvlndgahfgkegkyfa
    rlnvatpkntvqealsriisvf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3l8aB (B:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsmgrydfttrpdrlnqftykwktsenn
    pellqmwvadmdflpvpeikeaiinygrehifgynyfnddlyqavidwerkehdyavvke
    dilfidgvvpaisialqafsekgdavlinspvyypfartirlndhrlvenslqiingrfe
    idfeqlekdiidnnvkiyllcsphnpggrvwdnddlikiaelckkhgvilvsdeihqdla
    lfgnthhslntldasykdftiilssatktfniagtknsfaiiqneslrrkfqyrqlannq
    hevptvgmiatqaafqygkpwleelktviegniklvikeleaktkikvmepegtylvwld
    fsayaiaqpqlseklqneakvvlndgahfgkegkyfarlnvatpkntvqealsriisvfg
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l8aB (B:)
    rydfttrpdrlnqftykwktsennpellqmwvadmdflpvpeikeaiinygrehifgyny
    fnddlyqavidwerkehdyavvkedilfidgvvpaisialqafsekgdavlinspvyypf
    artirlndhrlvenslqiingrfeidfeqlekdiidnnvkiyllcsphnpggrvwdnddl
    ikiaelckkhgvilvsdeihqdlalfgnthhslntldasykdftiilssatktfniagtk
    nsfaiiqneslrrkfqyrqlannqhevptvgmiatqaafqygkpwleelktviegniklv
    ikeleaktkikvmepegtylvwldfsayaiaqpqlseklqneakvvlndgahfgkegkyf
    arlnvatpkntvqealsriisvfgk