PDB entry 3l88

View 3l88 on RCSB PDB site
Description: Crystal structure of the human Adenovirus type 21 fiber knob
Class: viral protein
Keywords: Adenovirus, Fiber Knob, Viral Protein
Deposited on 2009-12-30, released 2010-04-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-04-14, with a file datestamp of 2010-04-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.235
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fiber protein
    Species: Human adenovirus 21 [TaxId:32608]
    Gene: 32608, L5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l88a_
  • Chain 'B':
    Compound: fiber protein
    Species: Human adenovirus 21 [TaxId:32608]
    Gene: 32608, L5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l88b_
  • Chain 'C':
    Compound: fiber protein
    Species: Human adenovirus 21 [TaxId:32608]
    Gene: 32608, L5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l88c_
  • Chain 'D':
    Compound: fiber protein
    Species: Human adenovirus 21 [TaxId:32608]
    Gene: 32608, L5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l88d_
  • Chain 'E':
    Compound: fiber protein
    Species: Human adenovirus 21 [TaxId:32608]
    Gene: 32608, L5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l88e_
  • Chain 'F':
    Compound: fiber protein
    Species: Human adenovirus 21 [TaxId:32608]
    Gene: 32608, L5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l88f_
  • Chain 'G':
    Compound: fiber protein
    Species: Human adenovirus 21 [TaxId:32608]
    Gene: 32608, L5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l88g_
  • Chain 'H':
    Compound: fiber protein
    Species: Human adenovirus 21 [TaxId:32608]
    Gene: 32608, L5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l88h_
  • Chain 'I':
    Compound: fiber protein
    Species: Human adenovirus 21 [TaxId:32608]
    Gene: 32608, L5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l88i_
  • Chain 'J':
    Compound: fiber protein
    Species: Human adenovirus 21 [TaxId:32608]
    Gene: 32608, L5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l88j_
  • Chain 'K':
    Compound: fiber protein
    Species: Human adenovirus 21 [TaxId:32608]
    Gene: 32608, L5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l88k_
  • Chain 'L':
    Compound: fiber protein
    Species: Human adenovirus 21 [TaxId:32608]
    Gene: 32608, L5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l88l_
  • Heterogens: NA, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l88A (A:)
    gdicikdsintlwtgikpppncqiventdtndgkltlvlvkngglvngyvslvgvsdtvn
    qmftqksatiqlrlyfdssgnlltdesnlkiplknksstatseaatsskafmpsttaypf
    ntttrdsenyihgicyymtsydrslvplnisimlnsrtissnvayaiqfewnlnakespe
    sniatlttspfffsyireddn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l88A (A:)
    intlwtgikpppncqiventdtndgkltlvlvkngglvngyvslvgvsdtvnqmftqksa
    tiqlrlyfdssgnlltdesnlkiplknksssskafmpsttaypfntttrdsenyihgicy
    ymtsydrslvplnisimlnsrtissnvayaiqfewnlnakespesniatlttspfffsyi
    red
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3l88B (B:)
    gdicikdsintlwtgikpppncqiventdtndgkltlvlvkngglvngyvslvgvsdtvn
    qmftqksatiqlrlyfdssgnlltdesnlkiplknksstatseaatsskafmpsttaypf
    ntttrdsenyihgicyymtsydrslvplnisimlnsrtissnvayaiqfewnlnakespe
    sniatlttspfffsyireddn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l88B (B:)
    intlwtgikpppncqiventdtndgkltlvlvkngglvngyvslvgvsdtvnqmftqksa
    tiqlrlyfdssgnlltdesnlkiplknksssskafmpsttaypfntttrdsenyihgicy
    ymtsydrslvplnisimlnsrtissnvayaiqfewnlnakespesniatlttspfffsyi
    red
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3l88C (C:)
    gdicikdsintlwtgikpppncqiventdtndgkltlvlvkngglvngyvslvgvsdtvn
    qmftqksatiqlrlyfdssgnlltdesnlkiplknksstatseaatsskafmpsttaypf
    ntttrdsenyihgicyymtsydrslvplnisimlnsrtissnvayaiqfewnlnakespe
    sniatlttspfffsyireddn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l88C (C:)
    intlwtgikpppncqiventdtndgkltlvlvkngglvngyvslvgvsdtvnqmftqksa
    tiqlrlyfdssgnlltdesnlkiplknksstsskafmpsttaypfntttrdsenyihgic
    yymtsydrslvplnisimlnsrtissnvayaiqfewnlnakespesniatlttspfffsy
    ired
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3l88D (D:)
    gdicikdsintlwtgikpppncqiventdtndgkltlvlvkngglvngyvslvgvsdtvn
    qmftqksatiqlrlyfdssgnlltdesnlkiplknksstatseaatsskafmpsttaypf
    ntttrdsenyihgicyymtsydrslvplnisimlnsrtissnvayaiqfewnlnakespe
    sniatlttspfffsyireddn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l88D (D:)
    intlwtgikpppncqiventdtndgkltlvlvkngglvngyvslvgvsdtvnqmftqksa
    tiqlrlyfdssgnlltdesnlkiplknksssskafmpsttaypfntttrdsenyihgicy
    ymtsydrslvplnisimlnsrtissnvayaiqfewnlnakespesniatlttspfffsyi
    red
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3l88E (E:)
    gdicikdsintlwtgikpppncqiventdtndgkltlvlvkngglvngyvslvgvsdtvn
    qmftqksatiqlrlyfdssgnlltdesnlkiplknksstatseaatsskafmpsttaypf
    ntttrdsenyihgicyymtsydrslvplnisimlnsrtissnvayaiqfewnlnakespe
    sniatlttspfffsyireddn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l88E (E:)
    intlwtgikpppncqiventdtndgkltlvlvkngglvngyvslvgvsdtvnqmftqksa
    tiqlrlyfdssgnlltdesnlkiplknksssskafmpsttaypfntttrdsenyihgicy
    ymtsydrslvplnisimlnsrtissnvayaiqfewnlnakespesniatlttspfffsyi
    red
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3l88F (F:)
    gdicikdsintlwtgikpppncqiventdtndgkltlvlvkngglvngyvslvgvsdtvn
    qmftqksatiqlrlyfdssgnlltdesnlkiplknksstatseaatsskafmpsttaypf
    ntttrdsenyihgicyymtsydrslvplnisimlnsrtissnvayaiqfewnlnakespe
    sniatlttspfffsyireddn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l88F (F:)
    intlwtgikpppncqiventdtndgkltlvlvkngglvngyvslvgvsdtvnqmftqksa
    tiqlrlyfdssgnlltdesnlkiplknksssskafmpsttaypfntttrdsenyihgicy
    ymtsydrslvplnisimlnsrtissnvayaiqfewnlnakespesniatlttspfffsyi
    red
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3l88G (G:)
    gdicikdsintlwtgikpppncqiventdtndgkltlvlvkngglvngyvslvgvsdtvn
    qmftqksatiqlrlyfdssgnlltdesnlkiplknksstatseaatsskafmpsttaypf
    ntttrdsenyihgicyymtsydrslvplnisimlnsrtissnvayaiqfewnlnakespe
    sniatlttspfffsyireddn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l88G (G:)
    intlwtgikpppncqiventdtndgkltlvlvkngglvngyvslvgvsdtvnqmftqksa
    tiqlrlyfdssgnlltdesnlkiplknksssskafmpsttaypfntttrdsenyihgicy
    ymtsydrslvplnisimlnsrtissnvayaiqfewnlnakespesniatlttspfffsyi
    red
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3l88H (H:)
    gdicikdsintlwtgikpppncqiventdtndgkltlvlvkngglvngyvslvgvsdtvn
    qmftqksatiqlrlyfdssgnlltdesnlkiplknksstatseaatsskafmpsttaypf
    ntttrdsenyihgicyymtsydrslvplnisimlnsrtissnvayaiqfewnlnakespe
    sniatlttspfffsyireddn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l88H (H:)
    sintlwtgikpppncqiventdtndgkltlvlvkngglvngyvslvgvsdtvnqmftqks
    atiqlrlyfdssgnlltdesnlkiplknkssskafmpsttaypfntttrdsenyihgicy
    ymtsydrslvplnisimlnsrtissnvayaiqfewnlnakespesniatlttspfffsyi
    red
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3l88I (I:)
    gdicikdsintlwtgikpppncqiventdtndgkltlvlvkngglvngyvslvgvsdtvn
    qmftqksatiqlrlyfdssgnlltdesnlkiplknksstatseaatsskafmpsttaypf
    ntttrdsenyihgicyymtsydrslvplnisimlnsrtissnvayaiqfewnlnakespe
    sniatlttspfffsyireddn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l88I (I:)
    intlwtgikpppncqiventdtndgkltlvlvkngglvngyvslvgvsdtvnqmftqksa
    tiqlrlyfdssgnlltdesnlkiplknksssskafmpsttaypfntttrdsenyihgicy
    ymtsydrslvplnisimlnsrtissnvayaiqfewnlnakespesniatlttspfffsyi
    red
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3l88J (J:)
    gdicikdsintlwtgikpppncqiventdtndgkltlvlvkngglvngyvslvgvsdtvn
    qmftqksatiqlrlyfdssgnlltdesnlkiplknksstatseaatsskafmpsttaypf
    ntttrdsenyihgicyymtsydrslvplnisimlnsrtissnvayaiqfewnlnakespe
    sniatlttspfffsyireddn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l88J (J:)
    intlwtgikpppncqiventdtndgkltlvlvkngglvngyvslvgvsdtvnqmftqksa
    tiqlrlyfdssgnlltdesnlkiplknkssskafmpsttaypfntttrdsenyihgicyy
    mtsydrslvplnisimlnsrtissnvayaiqfewnlnakespesniatlttspfffsyir
    ed
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3l88K (K:)
    gdicikdsintlwtgikpppncqiventdtndgkltlvlvkngglvngyvslvgvsdtvn
    qmftqksatiqlrlyfdssgnlltdesnlkiplknksstatseaatsskafmpsttaypf
    ntttrdsenyihgicyymtsydrslvplnisimlnsrtissnvayaiqfewnlnakespe
    sniatlttspfffsyireddn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l88K (K:)
    intlwtgikpppncqiventdtndgkltlvlvkngglvngyvslvgvsdtvnqmftqksa
    tiqlrlyfdssgnlltdesnlkiplknksssskafmpsttaypfntttrdsenyihgicy
    ymtsydrslvplnisimlnsrtissnvayaiqfewnlnakespesniatlttspfffsyi
    red
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3l88L (L:)
    gdicikdsintlwtgikpppncqiventdtndgkltlvlvkngglvngyvslvgvsdtvn
    qmftqksatiqlrlyfdssgnlltdesnlkiplknksstatseaatsskafmpsttaypf
    ntttrdsenyihgicyymtsydrslvplnisimlnsrtissnvayaiqfewnlnakespe
    sniatlttspfffsyireddn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l88L (L:)
    sintlwtgikpppncqiventdtndgkltlvlvkngglvngyvslvgvsdtvnqmftqks
    atiqlrlyfdssgnlltdesnlkiplknksskafmpsttaypfntttrdsenyihgicyy
    mtsydrslvplnisimlnsrtissnvayaiqfewnlnakespesniatlttspfffsyir
    ed