PDB entry 3l82

View 3l82 on RCSB PDB site
Description: X-ray Crystal structure of TRF1 and Fbx4 complex
Class: cell cycle
Keywords: TRFH domain, helix, GTPase domain, Acetylation, ADP-ribosylation, Alternative splicing, Cell cycle, Cell division, Chromosomal protein, Cytoplasm, Cytoskeleton, DNA-binding, Mitosis, Nucleus, Phosphoprotein, Telomere, Ubl conjugation pathway
Deposited on 2009-12-29, released 2010-03-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-03-09, with a file datestamp of 2010-03-05.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.237
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Telomeric repeat-binding factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TERF1, PIN2, TRBF1, TRF, TRF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3l82a_
  • Chain 'B':
    Compound: F-box only protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: FBXO4, FBX4
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3l82A (A:)
plgseeeeedaglvaeaeavaagwmldflclslcrafrdgrsedfrrtrnsaeaiihgls
sltacqlrtiyicqfltriaagktldaqfenderitplesalmiwgsiekehdklheeiq
nlikiqaiavcmengnfkeaeevferifgdpnshmpfkskllmiisqkdtfhsffqhfsy
nhmmekiksyvnyvlseksstflmkaaakvveskr

    Sequence, based on observed residues (ATOM records): (download) 
    >3l82A (A:)
aglvaeaeavaagwmldflclslcrafrdgrsedfrrtrnsaeaiihglssltacqlrti
yicqfltriaagktldaqfenderitplesalmiwgsiekehdklheeiqnlikiqaiav
cmengnfkeaeevferifgdpnshmpfkskllmiisqkdtfhsffqhfsynhmmekiksy
vnyvlseksstflmkaaakvves

  • Chain 'B':
    No sequence available.