PDB entry 3l81

View 3l81 on RCSB PDB site
Description: Crystal structure of adaptor protein complex 4 (AP-4) mu4 subunit C-terminal domain, in complex with a sorting peptide from the amyloid precursor protein (APP)
Class: transport protein
Keywords: immunoglobulin-like beta-sandwich, Coated pit, Golgi apparatus, Membrane, Phosphoprotein, Protein transport, Transport, Alzheimer disease, Amyloid, Amyloidosis, TRANSPORT PROTEIN
Deposited on 2009-12-29, released 2010-06-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AP-4 complex subunit mu-1
    Species: Homo sapiens [TaxId:9606]
    Gene: AP4M1, MUARP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00189 (Start-300)
      • engineered (82)
    Domains in SCOPe 2.08: d3l81a_
  • Chain 'B':
    Compound: amyloid beta a4 protein
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l81A (A:)
    gamdpefqqskvapssaasrpvlssrsdqsqknevfldvverlsvliasngsllkvdvqg
    eirlksflpsgsemriglteefsvgkselrgygpgirvdevsfhssvnldefeshrilrl
    qppqgeltvmryqlsddlpsplpfrlfpsvqwdrgsgrlqvylklrcdllsksqalnvrl
    hlplprgvvslsqelsspeqkaelaegalrwdlprvqggsqlsglfqmdvpgppgppshg
    lstsasplglgpaslsfelprhtcsglqvrflrlafrpsgnanphkwvrhlshsdayvir
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l81A (A:)
    nevfldvverlsvliasngsllkvdvqgeirlksflpsgsemriglteefsvgkselrgy
    gpgirvdevsfhssvnldefeshrilrlqppqgeltvmryqlsddlpsplpfrlfpsvqw
    drgsgrlqvylklrcdllsksqalnvrlhlplprgvvslsqelsspeqkaelaegalrwd
    lprvqggsqlsglfqmdvpgppglglgpaslsfelprhtcsglqvrflrlafphkwvrhl
    shsdayviri
    

  • Chain 'B':
    No sequence available.