PDB entry 3l7z

View 3l7z on RCSB PDB site
Description: Crystal structure of the S. solfataricus archaeal exosome
Class: hydrolase/RNA binding protein
Keywords: Exosome, asymmetry, RNA processing, RNA degradation, conformation flexibility, thermal motion, hydrolase-RNA binding protein complex
Deposited on 2009-12-29, released 2010-06-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: 0.266
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: C20_023, Rrp41/42/4, SSO0732
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3l7za1, d3l7za2
  • Chain 'B':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: SSO0735
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Probable exosome complex RNA-binding protein 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: C20_026, SSO0736
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3l7zc1, d3l7zc2, d3l7zc3
  • Chain 'D':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: C20_023, Rrp41/42/4, SSO0732
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UXC0 (0-270)
      • engineered (95)
    Domains in SCOPe 2.05: d3l7zd1, d3l7zd2
  • Chain 'E':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: SSO0735
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Probable exosome complex RNA-binding protein 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: C20_026, SSO0736
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: C20_023, Rrp41/42/4, SSO0732
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UXC0 (0-End)
      • engineered (95)
    Domains in SCOPe 2.05: d3l7zg1, d3l7zg2
  • Chain 'H':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: SSO0735
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Probable exosome complex RNA-binding protein 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: C20_026, SSO0736
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3l7zi1, d3l7zi2, d3l7zi3
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l7zA (A:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayttfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnk
    nevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkg
    smslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l7zA (A:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellppdenaielarvvdrslrdskaldltklv
    iepgksvwtvwldvyvldyggnvldactlasvaalyntkvykvvgklplnypvvtisvak
    vdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqaentarstavk
    lleelkkhlgi
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3l7zC (C:)
    mnmsqsqkivlqprsivvpgellaegefqipwspyilkinskyystvvglfdvkdtqfev
    iplegsfyypkindiviglvedveiygwvvdikapykaylpasnllgrsinvgedlrryl
    dvgdyviarienfdrsidpvlsvkgkdlgrvsngividimpvkvprvigknksmyetlts
    ksgcsifvanngriwatcpsrfseeilieairkieneshikgltdrikqfieeklgerna
    ssgetktns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l7zC (C:)
    qkivlqprsivvpgellaegefqipwspyilkinskyystvvglfdvkdtqfeviplegs
    fyypkindiviglvedveiygwvvdikapykaylpasnllgrsinvgedlrryldvgdyv
    iarienfdrsidpvlsvkgkdlgrvsngividimpvkvprvigknksmyetltsksgcsi
    fvanngriwatcpsrfseeilieairkieneshikgltdrik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3l7zD (D:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayttfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnk
    nevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkg
    smslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l7zD (D:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayttfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykvvgklpln
    ypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqa
    entarstavklleelkkhlgi
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3l7zG (G:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayttfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnk
    nevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkg
    smslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l7zG (G:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayttfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnk
    nevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkg
    smslqdidqaentarstavklleelkkhlg
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3l7zI (I:)
    mnmsqsqkivlqprsivvpgellaegefqipwspyilkinskyystvvglfdvkdtqfev
    iplegsfyypkindiviglvedveiygwvvdikapykaylpasnllgrsinvgedlrryl
    dvgdyviarienfdrsidpvlsvkgkdlgrvsngividimpvkvprvigknksmyetlts
    ksgcsifvanngriwatcpsrfseeilieairkieneshikgltdrikqfieeklgerna
    ssgetktns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l7zI (I:)
    kivlqprsivvpgellaegefqipwspyilkinskyystvvglfdvkdfeviplegsfyy
    pkindiviglvedveiygwvvdikapykaylpasnllgrsinvgeyldvgdyviarienf
    drsidpvlsvkgkdlgrvsngividimpvkvprvigknksmyetltsksgcsifvanngr
    iwateilieairkieneshikgltdr