PDB entry 3l7y

View 3l7y on RCSB PDB site
Description: The Crystal Structure of SMU.1108c from Streptococcus mutans UA159
Class: hydrolase
Keywords: Hydrolase
Deposited on 2009-12-29, released 2010-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.191
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein smu.1108c
    Species: Streptococcus mutans [TaxId:210007]
    Gene: smu.1108c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l7ya_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l7yA (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsmsvkviatdmdgtflnskgsydhnrf
    qrilkqlqerdirfvvassnpyrqlrehfpdcheqltfvgenganiisknqslievfqqr
    ediasiiyfieekypqavialsgekkgylkkgvsenivkmlspffpvlelvnsfsplpde
    rffkltlqvkeeesaqimkaiadyktsqrlvgtasgfgyidiitkglhkgwalqqllkrw
    nftsdhlmafgdggndiemlklakysyamanapknvkaaanyqaksndesgvldvidnyl
    asid
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l7yA (A:)
    svkviatdmdgtflnskgsydhnrfqrilkqlqerdirfvvassnpyrqlrehfpdcheq
    ltfvgenganiisknqslievfqqrediasiiyfieekypqavialsgekkgylkkgvse
    nivkmlspffpvlelvnsfsplperffkltlqvkeeesaqimkaiadyktsqrlvgtasg
    fgyidiitkglhkgwalqqllkrwnftsdhlmafgdggndiemlklakysyamanapknv
    kaaanyqaksndesgvldvidnylas