PDB entry 3l7u

View 3l7u on RCSB PDB site
Description: Crystal structure of human NM23-H1
Class: transferase
Keywords: Kinase, ATP-binding, Nucleotide-binding, Transferase, Tumor suppressor
Deposited on 2009-12-29, released 2010-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-11-10, with a file datestamp of 2010-11-05.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.224
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside Diphosphate Kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: NME1, NDPKA, NM23
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l7ua_
  • Chain 'B':
    Compound: Nucleoside Diphosphate Kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: NME1, NDPKA, NM23
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15531 (20-171)
      • expression tag (18-19)
    Domains in SCOPe 2.07: d3l7ub1, d3l7ub2
  • Chain 'C':
    Compound: Nucleoside Diphosphate Kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: NME1, NDPKA, NM23
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l7uc_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l7uA (A:)
    mgsshhhhhhssglvprgshmancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkf
    mqasedllkehyvdlkdrpffaglvkymhsgpvvamvweglnvvktgrvmlgetnpadsk
    pgtirgdfciqvgrniihgsdsvesaekeiglwfhpeelvdytscaqnwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l7uA (A:)
    mancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpf
    faglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgs
    dsvesaekeiglwfhpeelvdytscaqnwiye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3l7uB (B:)
    mgsshhhhhhssglvprgshmancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkf
    mqasedllkehyvdlkdrpffaglvkymhsgpvvamvweglnvvktgrvmlgetnpadsk
    pgtirgdfciqvgrniihgsdsvesaekeiglwfhpeelvdytscaqnwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l7uB (B:)
    shmancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdr
    pffaglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniih
    gsdsvesaekeiglwfhpeelvdytscaqnwiye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3l7uC (C:)
    mgsshhhhhhssglvprgshmancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkf
    mqasedllkehyvdlkdrpffaglvkymhsgpvvamvweglnvvktgrvmlgetnpadsk
    pgtirgdfciqvgrniihgsdsvesaekeiglwfhpeelvdytscaqnwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l7uC (C:)
    mancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpf
    faglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgs
    dsvesaekeiglwfhpeelvdytscaqnwiye