PDB entry 3l7f

View 3l7f on RCSB PDB site
Description: Structure of IL-13 antibody H2L6, A humanized variant OF C836
Class: immune system
Keywords: immunoglobulin fold, MONOCLONAL ANTIBODY, IMMUNE SYSTEM
Deposited on 2009-12-28, released 2010-11-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-11-10, with a file datestamp of 2010-11-05.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.207
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: h2l6 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3L7F (0-End)
    Domains in SCOPe 2.03: d3l7fa1, d3l7fa2
  • Chain 'B':
    Compound: h2l6 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3L7F (0-End)
  • Chain 'D':
    Compound: h2l6 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3L7F (0-End)
    Domains in SCOPe 2.03: d3l7fd1, d3l7fd2
  • Chain 'E':
    Compound: h2l6 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3L7F (0-End)
  • Chain 'H':
    Compound: h2l6 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3L7F (0-End)
  • Chain 'L':
    Compound: h2l6 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3L7F (0-End)
    Domains in SCOPe 2.03: d3l7fl1, d3l7fl2
  • Heterogens: SO4, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l7fA (A:)
    eivltqspatlslspgeratlscrasksiskylawyqqkpgqaprlliysgstlqsgipa
    rfsgsgsgtdftltisslepedfavyycqqhneypytfgqgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l7fA (A:)
    eivltqspatlslspgeratlscrasksiskylawyqqkpgqaprlliysgstlqsgipa
    rfsgsgsgtdftltisslepedfavyycqqhneypytfgqgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3l7fD (D:)
    eivltqspatlslspgeratlscrasksiskylawyqqkpgqaprlliysgstlqsgipa
    rfsgsgsgtdftltisslepedfavyycqqhneypytfgqgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l7fD (D:)
    eivltqspatlslspgeratlscrasksiskylawyqqkpgqaprlliysgstlqsgipa
    rfsgsgsgtdftltisslepedfavyycqqhneypytfgqgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'E':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3l7fL (L:)
    eivltqspatlslspgeratlscrasksiskylawyqqkpgqaprlliysgstlqsgipa
    rfsgsgsgtdftltisslepedfavyycqqhneypytfgqgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l7fL (L:)
    eivltqspatlslspgeratlscrasksiskylawyqqkpgqaprlliysgstlqsgipa
    rfsgsgsgtdftltisslepedfavyycqqhneypytfgqgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge