PDB entry 3l7e

View 3l7e on RCSB PDB site
Description: Crystal structure of ANTI-IL-13 antibody C836
Class: immune system
Keywords: immunoglobulin fold, MONOCLONAL ANTIBODY, IMMUNE SYSTEM
Deposited on 2009-12-28, released 2010-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-26, with a file datestamp of 2011-10-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.204
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c836 light chain
    Species: Mus musculus, Homo sapiens [TaxId:10090,9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3L7E (0-End)
    Domains in SCOPe 2.07: d3l7ea1, d3l7ea2
  • Chain 'B':
    Compound: c836 heavy chain
    Species: Mus musculus, Homo sapiens [TaxId:10090,9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3L7E (0-End)
  • Chain 'H':
    Compound: c836 heavy chain
    Species: Mus musculus, Homo sapiens [TaxId:10090,9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3L7E (0-End)
  • Chain 'L':
    Compound: c836 light chain
    Species: Mus musculus, Homo sapiens [TaxId:10090,9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3L7E (0-End)
    Domains in SCOPe 2.07: d3l7el1, d3l7el2
  • Heterogens: SO4, GOL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l7eA (A:)
    dvqitqspsylaaspgetitlncrasksiskylawyqekpgktnklliysgstlqsgips
    rfsgsgsgtdftltisslepedfamyfcqqhneypytfgggtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l7eA (A:)
    dvqitqspsylaaspgetitlncrasksiskylawyqekpgktnklliysgstlqsgips
    rfsgsgsgtdftltisslepedfamyfcqqhneypytfgggtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3l7eL (L:)
    dvqitqspsylaaspgetitlncrasksiskylawyqekpgktnklliysgstlqsgips
    rfsgsgsgtdftltisslepedfamyfcqqhneypytfgggtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l7eL (L:)
    dvqitqspsylaaspgetitlncrasksiskylawyqekpgktnklliysgstlqsgips
    rfsgsgsgtdftltisslepedfamyfcqqhneypytfgggtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge