PDB entry 3l7c

View 3l7c on RCSB PDB site
Description: Crystal Structure of Glycogen Phosphorylase DK4 complex
Class: transferase
Keywords: GLYCOGENOLYSIS, TYPE 2 DIABETES, allosteric enzyme, CARBOHYDRATE METABOLISM, GLYCOGEN METABOLISM, GLYCOSYLTRANSFERASE, NUCLEOTIDE-BINDING, PHOSPHORYLATION, PYRIDOXAL PHOSPHATE, TRANSFERASE, Phosphoprotein
Deposited on 2009-12-28, released 2010-10-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-10-20, with a file datestamp of 2010-10-15.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.176
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l7ca_
  • Heterogens: DK4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l7cA (A:)
    msrplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtv
    rdhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldm
    eeleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeea
    ddwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvn
    tmrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfv
    vaatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerl
    dwdkawevtvktcaytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafp
    gdvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkf
    qnktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkq
    enklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvv
    prtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipa
    adlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvd
    rldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyee
    yvkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapde
    kip
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l7cA (A:)
    qisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtq
    qhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedagl
    gngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpwek
    arpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapnd
    fnlgyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfksskrt
    nfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpeal
    erwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahl
    ciagshavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiia
    erigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfd
    vqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklit
    aigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmln
    galtigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieq
    lssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirn
    iatsgkfssdrtiaqyareiwgvepsrqrlpa