PDB entry 3l6t

View 3l6t on RCSB PDB site
Description: Crystal Structure of an N-terminal Mutant of the Plasmid pCU1 TraI Relaxase Domain
Class: hydrolase
Keywords: TrwC Superfamily of relaxase enzymes, conjugative relaxase, mob class relaxase, conjugal nickase, hydrolase, histidine triad, HUH+H motif
Deposited on 2009-12-24, released 2010-05-19
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-10-06, with a file datestamp of 2010-10-01.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.169
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mobilization protein TraI
    Species: Escherichia coli [TaxId:562]
    Gene: pMUR050_047, traI
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X4G2 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d3l6ta_
  • Chain 'B':
    Compound: Mobilization protein TraI
    Species: Escherichia coli [TaxId:562]
    Gene: pMUR050_047, traI
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X4G2 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d3l6tb_
  • Heterogens: CIT, EDO, NI, CL, PO4, MG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l6tA (A:)
    snamldittitrqnvtsvvgyysdakddyyskdssftswqgtgaealglsgdvesarfke
    llvgeidtfthmqrhvgdakkerlgydltfsapkgvsmqalihgdktiieahekavaaav
    reaeklaqarttrqgksvtqntnnlvvatfrhetsraldpdlhthafvmnmtqredgqwr
    alkndelmrnkmhlgdvykqelaleltkagyelrynsknntfdmahfsdeqirafsrrse
    qiekglaamgltretadaqtksrvsmatrekktehsreeihqewasraktlgidfdnrew
    qg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l6tA (A:)
    snamldittitrqnvtsvvgyysdakddyyskdssftswqgtgaealglsgdvesarfke
    llvgeidtfthmqrhvgdakkerlgydltfsapkgvsmqalihgdktiieahekavaaav
    reaeklaqarttrksvtqntnnlvvatfrhetsraldpdlhthafvmnmtqredgqwral
    kndelmrnkmhlgdvykqelaleltkagyelrynsknntfdmahfs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3l6tB (B:)
    snamldittitrqnvtsvvgyysdakddyyskdssftswqgtgaealglsgdvesarfke
    llvgeidtfthmqrhvgdakkerlgydltfsapkgvsmqalihgdktiieahekavaaav
    reaeklaqarttrqgksvtqntnnlvvatfrhetsraldpdlhthafvmnmtqredgqwr
    alkndelmrnkmhlgdvykqelaleltkagyelrynsknntfdmahfsdeqirafsrrse
    qiekglaamgltretadaqtksrvsmatrekktehsreeihqewasraktlgidfdnrew
    qg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l6tB (B:)
    snamldittitrqnvtsvvftswqgtgaealglsgdvesarfkellvgeidtfthmqrhk
    kerlgydltfsapkgvsmqalihgdktiieahekavaaavreaeklaqarttrqgksvtq
    ntnnlvvatfrhetldpdlhthafvmnmtqredgqwralkndelmrnkmhlgdvykqela
    leltkagyelrynsknntfdmah