PDB entry 3l6e

View 3l6e on RCSB PDB site
Description: Crystal structure of putative short chain dehydrogenase/reductase family oxidoreductase from Aeromonas hydrophila subsp. hydrophila ATCC 7966
Class: oxidoreductase
Keywords: STRUCTURAL GENOMICS, PSI-2, Protein Structure Initiative, oxidoreductase, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2009-12-23, released 2010-02-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.221
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oxidoreductase, short-chain dehydrogenase/reductase family
    Species: Aeromonas hydrophila subsp. hydrophila [TaxId:380703]
    Gene: ABK37325.1, AHA_3651
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0KPA6 (3-226)
      • expression tag (2)
      • conflict (41)
      • conflict (44)
      • conflict (48)
      • conflict (54)
      • conflict (62)
      • conflict (86)
      • conflict (104)
      • conflict (109)
      • conflict (124-125)
      • conflict (167)
      • expression tag (227-228)
    Domains in SCOPe 2.05: d3l6ea_
  • Chain 'B':
    Compound: Oxidoreductase, short-chain dehydrogenase/reductase family
    Species: Aeromonas hydrophila subsp. hydrophila [TaxId:380703]
    Gene: ABK37325.1, AHA_3651
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0KPA6 (3-226)
      • expression tag (2)
      • conflict (41)
      • conflict (44)
      • conflict (48)
      • conflict (54)
      • conflict (62)
      • conflict (86)
      • conflict (104)
      • conflict (109)
      • conflict (124-125)
      • conflict (167)
      • expression tag (227)
    Domains in SCOPe 2.05: d3l6eb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l6eA (A:)
    mslghiivtgagsglgraltiglverghqvsmmgrryqrlqqqelllgnavigivadlah
    hedvdvafaaavewgglpelvlhcagtgefgpvgvytaeqirrvmesnlvstilvaqqtv
    rligerggvlanvlssaaqvgkaneslycaskwgmrgfleslraelkdsplrlvnlypsg
    irsefwdntdhvdpsgfmtpedaaaymldalearsschvtdlfigrneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l6eA (A:)
    lghiivtgagsglgraltiglverghqvsmmgrryqrlqqqelllgnavigivadlahhe
    dvdvafaaavewgglpelvlhcagtgvytaeqirrvmesnlvstilvaqqtvrligergg
    vlanvlssaaqvgkaneslycaskwgmrgfleslraelkdsplrlvnlypsgirseffmt
    pedaaaymldalearsschvtdlfigrneg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3l6eB (B:)
    mslghiivtgagsglgraltiglverghqvsmmgrryqrlqqqelllgnavigivadlah
    hedvdvafaaavewgglpelvlhcagtgefgpvgvytaeqirrvmesnlvstilvaqqtv
    rligerggvlanvlssaaqvgkaneslycaskwgmrgfleslraelkdsplrlvnlypsg
    irsefwdntdhvdpsgfmtpedaaaymldalearsschvtdlfigrneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l6eB (B:)
    lghiivtgagsglgraltiglverghqvsmmgrryqrlqqqelllgnavigivadlahhe
    dvdvafaaavewgglpelvlhcagtgefytaeqirrvmesnlvstilvaqqtvrligerg
    gvlanvlssaaqvgkaneslycaskwgmrgfleslraelkdsplrlvnlypsgirseffm
    tpedaaaymldalearsschvtdlfigrne