PDB entry 3l69

View 3l69 on RCSB PDB site
Description: Crystal structure of porcine pancreatic phospholipase A2 complexed with berberine
Class: hydrolase
Keywords: Phospholipase A2, Berberine, Disulfide bond, Hydrolase, Lipid degradation, Lipoprotein, Palmitate, Pyrrolidone carboxylic acid, Secreted
Deposited on 2009-12-23, released 2010-01-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-01-25, with a file datestamp of 2012-01-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.19
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2, major isoenzyme
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l69a_
  • Heterogens: BER, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l69A (A:)
    alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
    ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
    kkyc