PDB entry 3l64

View 3l64 on RCSB PDB site
Description: T4 Lysozyme S44E/WT*
Class: hydrolase
Keywords: hydrolase (O-glycosyl), Antimicrobial, Bacteriolytic enzyme, Glycosidase, Hydrolase
Deposited on 2009-12-23, released 2010-01-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: E
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-163)
      • engineered (43)
      • engineered (53)
      • engineered (96)
    Domains in SCOPe 2.08: d3l64a_
  • Heterogens: BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3l64A (A:)
mnifemlrideglrlkiykdtegyytigighlltkspslnaakeeldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl