PDB entry 3l61

View 3l61 on RCSB PDB site
Description: Crystal structure of substrate-free P450cam at 200 mM [K+]
Class: oxidoreductase
Keywords: cytochrome P450, P450cam, camphor, substrate-free, open conformation, Metal-binding, Monooxygenase, OXIDOREDUCTASE
Deposited on 2009-12-22, released 2010-04-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-05-05, with a file datestamp of 2010-04-30.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.198
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Camphor 5-monooxygenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMC, CYP101
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183 (Start-413)
      • engineered (333)
    Domains in SCOPe 2.06: d3l61a_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l61A (A:)
    ttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcng
    ghwiatrgqlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvg
    mpvvdklenriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyl
    tdqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakr
    mcglllvggldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgri
    ltsdyefhgvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgq
    hlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l61A (A:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
    lireayedyrhfssecpfipfiptsmppeqrqfralanqvvgmpvvdklenriqelacsl
    ieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgsmtfaeake
    alydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggldtvvnfls
    fsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhgvqlkkgdqi
    llpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiivtlkewltri
    pdfsiapgaqiqhksgivsgvqalplvwdpattkav