PDB entry 3l5k

View 3l5k on RCSB PDB site
Description: The crystal structure of human Haloacid Dehalogenase-like Hydrolase Domain containing 1A (HDHD1A)
Class: hydrolase
Keywords: HDHD1A, Haloacid Dehalogenase-like Hydrolase Domain containing 1A, hydrolase, Structural Genomics, Structural Genomics Consortium, SGC, Polymorphism
Deposited on 2009-12-22, released 2010-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Haloacid dehalogenase-like hydrolase domain-containing protein 1A
    Species: Homo sapiens [TaxId:9606]
    Gene: HDHD1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08623 (22-249)
      • expression tag (17-21)
      • conflict (137)
    Domains in SCOPe 2.07: d3l5ka1, d3l5ka2
  • Heterogens: K, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l5kA (A:)
    mhhhhhhssgvdlgtenlyfqsmaappqpvthlifdmdgllldterlysvvfqeicnryd
    kkyswdvkslvmgkkaleaaqiiidvlqlpmskeelveesqtklkevfptaalmpgaekl
    iihlrkhgipfalatssrsasfdmktsrhkeffslfshivlgddpevqhgkpdpdiflac
    akrfspppamekclvfedapngveaalaagmqvvmvpdgnlsrdlttkatlvlnslqdfq
    pelfglpsye
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l5kA (A:)
    lyfqsmaappqpvthlifdmdgllldterlysvvfqeicnrydkkyswdvkslvmgkkal
    eaaqiiidvlqlpmskeelveesqtklkevfptaalmpgaekliihlrkhgipfalatss
    rsasfdmktsrhkeffslfshivlgddpevqhgkpdpdiflacakrfspppamekclvfe
    dapngveaalaagmqvvmvpdgnlsrdlttkatlvlnslqdfqpelfglpsye