PDB entry 3l57

View 3l57 on RCSB PDB site
Description: Crystal Structure of the Plasmid pCU1 TraI Relaxase Domain
Class: hydrolase
Keywords: TrwC superfamily of relaxase enzymes, conjugative relaxase, Mob class relaxase, conjugal nickase, hydrolase, histidine triad, HUH+H motif
Deposited on 2009-12-21, released 2010-05-19
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-10-06, with a file datestamp of 2010-10-01.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: 0.176
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mobilization protein TraI
    Species: Escherichia coli [TaxId:562]
    Gene: pMUR050_047, traI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3l57a_
  • Chain 'B':
    Compound: Mobilization protein TraI
    Species: Escherichia coli [TaxId:562]
    Gene: pMUR050_047, traI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3l57b_
  • Heterogens: MN3, EDO, PO4, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l57A (A:)
    mldittitrqnvtsvvgyysdakddyyskdssftswqgtgaealglsgdvesarfkellv
    geidtfthmqrhvgdakkerlgydltfsapkgvsmqalihgdktiieahekavaaavrea
    eklaqarttrqgksvtqntnnlvvatfrhetsraldpdlhthafvmnmtqredgqwralk
    ndelmrnkmhlgdvykqelaleltkagyelrynsknntfdmahfsdeqirafsrrseqie
    kglaamgltretadaqtksrvsmatrekktehsreeihqewasraktlgidfdnrewqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l57A (A:)
    mldittitrqnvtsvvgyysdakddyyskdssftswqgtgaealglsgdvesarfkellv
    geidtfthmqrhvgdakkerlgydltfsapkgvsmqalihgdktiieahekavaaavrea
    eklaqarttrqgksvtqntnnlvvatfrhetsrdpdlhthafvmnmtqredgqwralknd
    elmrnkmhlgdvykqelaleltkagyelrynsknntfdmahfs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3l57B (B:)
    mldittitrqnvtsvvgyysdakddyyskdssftswqgtgaealglsgdvesarfkellv
    geidtfthmqrhvgdakkerlgydltfsapkgvsmqalihgdktiieahekavaaavrea
    eklaqarttrqgksvtqntnnlvvatfrhetsraldpdlhthafvmnmtqredgqwralk
    ndelmrnkmhlgdvykqelaleltkagyelrynsknntfdmahfsdeqirafsrrseqie
    kglaamgltretadaqtksrvsmatrekktehsreeihqewasraktlgidfdnrewqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l57B (B:)
    mldittitrqnvtsvvgftswqgtgaealglsgdvesarfkellvgeidtfthmqrhkke
    rlgydltfsapkgvsmqalihgdktiieahekavaaavreaeklaqarttrqgksvtqnt
    nnlvvatfrhetsrldpdlhthafvmnmtqredgqwralkndelmrnkmhlgdvykqela
    leltkagyelrynsknntfdmah