PDB entry 3l4y

View 3l4y on RCSB PDB site
Description: Crystal complex of N-terminal Human Maltase-Glucoamylase with NR4-8II
Class: hydrolase
Keywords: Glycoside Hydrolase Family 31, Cell membrane, Disulfide bond, Glycoprotein, Glycosidase, Hydrolase, Membrane, Multifunctional enzyme, Polymorphism, Signal-anchor, Sulfation, Transmembrane
Deposited on 2009-12-21, released 2010-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Maltase-glucoamylase, intestinal
    Species: Homo sapiens [TaxId:9606]
    Gene: MGA, MGAM, MGAML
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43451 (Start-867)
      • variant (771)
      • expression tag (868-869)
    Domains in SCOPe 2.07: d3l4ya1, d3l4ya2, d3l4ya3, d3l4ya4, d3l4ya5
  • Heterogens: NR4, NAG, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l4yA (A:)
    saecpvvnelerincipdqpptkatcdqrgccwnpqgavsvpwcyysknhsyhvegnlvn
    tnagftarlknlpsspvfgsnvdnvlltaeyqtsnrfhfkltdqtnnrfevphehvqsfs
    gnaaasltyqveisrqpfsikvtrrsnnrvlfdssigpllfadqflqlstrlpstnvygl
    gehvhqqyrhdmnwktwpifnrdttpngngtnlygaqtfflcledasglsfgvflmnsna
    mevvlqpapaityrtiggildfyvflgntpeqvvqeyleligrpalpsywalgfhlsrye
    ygtldnmrevvernraaqlpydvqhadidymderrdftydsvdfkgfpefvnelhnngqk
    lviivdpaisnnsssskpygpydrgsdmkiwvnssdgvtpligevwpgqtvfpdytnpnc
    avwwtkefelfhnqvefdgiwidmnevsnfvdgsvsgcstnnlnnppftprildgylfck
    tlcmdavqhwgkqydihnlygysmavataeaaktvfpnkrsfiltrstfagsgkfaahwl
    gdntatwddlrwsipgvlefnlfgipmvgpdicgfaldtpeelcrrwmqlgafypfsrnh
    ngqgykdqdpasfgadslllnssrhylnirytllpylytlffrahsrgdtvarpllhefy
    ednstwdvhqqflwgpgllitpvldegaekvmayvpdavwydyetgsqvrwrkqkvemel
    pgdkiglhlrggyifptqqpntttlasrknplgliialdenkeakgelfwddgetkdtva
    nkvyllcefsvtqnrlevnisqstykdpnnlafneikilgteepsnvtvkhngvpsqtsp
    tvtydsnlkvaiitdidlllgeaytvewahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l4yA (A:)
    vnelerincipdqpptkatcdqrgccwnpqgavsvpwcyysknhsyhvegnlvntnagft
    arlknlpsspvfgsnvdnvlltaeyqtsnrfhfkltdqtnnrfevphehvqsfsgnaaas
    ltyqveisrqpfsikvtrrsnnrvlfdssigpllfadqflqlstrlpstnvyglgehvhq
    qyrhdmnwktwpifnrdttpngngtnlygaqtfflcledasglsfgvflmnsnamevvlq
    papaityrtiggildfyvflgntpeqvvqeyleligrpalpsywalgfhlsryeygtldn
    mrevvernraaqlpydvqhadidymderrdftydsvdfkgfpefvnelhnngqklviivd
    paisnnsssskpygpydrgsdmkiwvnssdgvtpligevwpgqtvfpdytnpncavwwtk
    efelfhnqvefdgiwidmnevsnfvdgsvsgcstnnlnnppftprildgylfcktlcmda
    vqhwgkqydihnlygysmavataeaaktvfpnkrsfiltrstfagsgkfaahwlgdntat
    wddlrwsipgvlefnlfgipmvgpdicgfaldtpeelcrrwmqlgafypfsrnhngqgyk
    dqdpasfgadslllnssrhylnirytllpylytlffrahsrgdtvarpllhefyednstw
    dvhqqflwgpgllitpvldegaekvmayvpdavwydyetgsqvrwrkqkvemelpgdkig
    lhlrggyifptqqpntttlasrknplgliialdenkeakgelfwddgetkdtvankvyll
    cefsvtqnrlevnisqstykdpnnlafneikilgteepsnvtvkhngvpstsptvtydsn
    lkvaiitdidlllgeaytvewah