PDB entry 3l45

View 3l45 on RCSB PDB site
Description: A Joint Neutron and X-ray structure of Oxidized Amicyanin
Class: Electron Transport
Keywords: Type-I Blue Copper Protein, Beta Sandwich, Electron Transport, Metal-binding
Deposited on 2009-12-18, released 2010-04-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-07.
Experiment type: NEUT+
Resolution: 1.8 Å
R-factor: 0.209
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amicyanin
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: ami, mauC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3l45a_
  • Heterogens: CU, DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3l45A (A:)
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve