PDB entry 3l44

View 3l44 on RCSB PDB site
Description: Crystal structure of Bacillus anthracis HemL-1, glutamate semialdehyde aminotransferase
Class: isomerase
Keywords: alpha beta class, PLP-dependent transferase-like, Bacillus anthracis, CSGID, Porphyrin biosynthesis, Pyridoxal phosphate, Structural Genomics, Center for Structural Genomics of Infectious Diseases, ISOMERASE
Deposited on 2009-12-18, released 2010-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate-1-semialdehyde 2,1-aminomutase 1
    Species: Bacillus anthracis [TaxId:261594]
    Gene: hemL1, BA_0531, GBAA_0531, BAS0499
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81YV0 (0-End)
      • conflict (334)
    Domains in SCOPe 2.07: d3l44a_
  • Chain 'B':
    Compound: Glutamate-1-semialdehyde 2,1-aminomutase 1
    Species: Bacillus anthracis [TaxId:261594]
    Gene: hemL1, BA_0531, GBAA_0531, BAS0499
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81YV0 (Start-433)
      • conflict (334)
    Domains in SCOPe 2.07: d3l44b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l44A (A:)
    mvvkftksealhkealehivggvnspsrsfkavgggapiamergkgayfwdvdgnkyidy
    laaygpiitghahphitkaittaaengvlygtptalevkfakmlkeampaldkvrfvnsg
    teavmttirvaraytgrtkimkfagcyhghsdlvlvaagsgpstlgtpdsagvpqsiaqe
    vitvpfnnvetlkealdkwghevaailvepivgnfgivepkpgflekvnelvheagalvi
    ydevitafrfmyggaqdllgvtpdltalgkviggglpigayggkkeimeqvaplgpayqa
    gtmagnpasmasgiaclevlqqeglyekldelgatlekgileqaakhniditlnrlkgal
    tvyfttntiedydaaqdtdgemfgkffklmlqegvnlapskyeawflttehtkedieyti
    eavgrafaaladnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l44A (A:)
    mvvkftksealhkealehivggvnspsrsfkavgggapiamergkgayfwdvdgnkyidy
    laaygpiitghahphitkaittaaengvlygtptalevkfakmlkeampaldkvrfvnsg
    teavmttirvaraytgrtkimkfagcyhghsdlvlvalgtpdsagvpqsiaqevitvpfn
    nvetlkealdkwghevaailvepivgnfgivepkpgflekvnelvheagalviydevita
    frfmyggaqdllgvtpdltalgkviggglpigayggkkeimeqvaplgpayqagtmagnp
    asmasgiaclevlqqeglyekldelgatlekgileqaakhniditlnrlkgaltvyfttn
    tiedydaaqdtdgemfgkffklmlqegvnlapskyeawflttehtkedieytieavgraf
    aaladn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3l44B (B:)
    mvvkftksealhkealehivggvnspsrsfkavgggapiamergkgayfwdvdgnkyidy
    laaygpiitghahphitkaittaaengvlygtptalevkfakmlkeampaldkvrfvnsg
    teavmttirvaraytgrtkimkfagcyhghsdlvlvaagsgpstlgtpdsagvpqsiaqe
    vitvpfnnvetlkealdkwghevaailvepivgnfgivepkpgflekvnelvheagalvi
    ydevitafrfmyggaqdllgvtpdltalgkviggglpigayggkkeimeqvaplgpayqa
    gtmagnpasmasgiaclevlqqeglyekldelgatlekgileqaakhniditlnrlkgal
    tvyfttntiedydaaqdtdgemfgkffklmlqegvnlapskyeawflttehtkedieyti
    eavgrafaaladnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l44B (B:)
    vvkftksealhkealehivggvnspsrsfkavgggapiamergkgayfwdvdgnkyidyl
    aaygpiitghahphitkaittaaengvlygtptalevkfakmlkeampaldkvrfvnsgt
    eavmttirvaraytgrtkimkfagcyhghsdlvlvaagsgpstlgtpdsagvpqsiaqev
    itvpfnnvetlkealdkwghevaailvepivgnfgivepkpgflekvnelvheagalviy
    devitafrfmyggaqdllgvtpdltalgkviggglpigayggkkeimeqvaplgpayqag
    tmagnpasmasgiaclevlqqeglyekldelgatlekgileqaakhniditlnrlkgalt
    vyfttntiedydaaqdtdgemfgkffklmlqegvnlapskyeawflttehtkedieytie
    avgrafaaladnk