PDB entry 3l3n

View 3l3n on RCSB PDB site
Description: Testis ACE co-crystal structure with novel inhibitor lisW
Class: hydrolase
Keywords: enzyme-inhibitor complex, Angiotensin-converting enzyme (ACE) inhibitors, testis, Carboxypeptidase, HYDROLASE
Deposited on 2009-12-17, released 2010-04-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-06-09, with a file datestamp of 2010-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.226
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiotensin-converting enzyme
    Species: Homo sapiens [TaxId:9606]
    Gene: ACE, DCP, DCP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12821
      • engineered (27)
      • engineered (53)
      • engineered (118)
      • engineered (300)
      • engineered (549)
    Domains in SCOPe 2.01: d3l3na_
  • Heterogens: ZN, CL, LSW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l3nA (A:)
    lvtdeaeaskfveeydrtsqvvwneyaganwnyntnittetskillqknmqiaqhtlkyg
    tqarkfdvnqlqnttikriikkvqdleraalpaqeleeynkilldmettysvatvchpqg
    sclqlepdltnvmatsrkyedllwawegwrdkagrailqfypkyvelinqaarlngyvda
    gdswrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllg
    nmwaqtwsniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefw
    qksmlekptdgrevvchasawdfyngkdfrikqcttvnledlvvahhemghiqyfmqykd
    lpvalreganpgfheaigdvlalsvstpkhlhslnllsseggsdehdinflmkmaldkia
    fipfsylvdqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhips
    svpyiryfvsfiiqfqfhealcqaaghtgplhkcdiyqskeagqrlatamklgfsrpwpe
    amqlitgqpqmsasamlsyfkplldwlrtenelhgeklgwpqynwtpnsar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l3nA (A:)
    deaeaskfveeydrtsqvvwneyaganwnyntnittetskillqknmqiaqhtlkygtqa
    rkfdvnqlqnttikriikkvqdleraalpaqeleeynkilldmettysvatvchpqgscl
    qlepdltnvmatsrkyedllwawegwrdkagrailqfypkyvelinqaarlngyvdagds
    wrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllgnmw
    aqtwsniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefwqks
    mlekptdgrevvchasawdfyngkdfrikqcttvnledlvvahhemghiqyfmqykdlpv
    alreganpgfheaigdvlalsvstpkhlhslnllsssdehdinflmkmaldkiafipfsy
    lvdqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhipssvpyir
    yfvsfiiqfqfhealcqaaghtgplhkcdiyqskeagqrlatamklgfsrpwpeamqlit
    gqpqmsasamlsyfkplldwlrtenelhgeklgwp