PDB entry 3l3l

View 3l3l on RCSB PDB site
Description: PARP complexed with A906894
Class: Transferase/Transferase Inhibitor
Keywords: Protein-Inhibitor Complex, ADP-ribosylation, DNA damage, DNA repair, DNA-binding, Glycosyltransferase, Metal-binding, NAD, Nucleus, Phosphoprotein, Transcription, Transcription regulation, Transferase, Transferase-Transferase Inhibitor complex
Deposited on 2009-12-17, released 2010-12-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-29, with a file datestamp of 2010-12-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.214
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly [ADP-ribose] polymerase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PARP1, ADPRT, PPOL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09874 (0-349)
      • engineered (100)
    Domains in SCOPe 2.07: d3l3la1, d3l3la2
  • Heterogens: L3L, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l3lA (A:)
    ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
    qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrgg
    sddsskdpidvnyeklktdikvvdrdseeaeiirkyvknthatthnaydlevidifkier
    egecqrykpfkqlhnrrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmv
    sksanychtsqgdpiglillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsan
    isldgvdvplgtgissgvndtsllyneyivydiaqvnlkyllklkfnfkt