PDB entry 3l3c

View 3l3c on RCSB PDB site
Description: Crystal structure of the Bacillus anthracis glmS ribozyme bound to Glc6P
Class: RNA binding protein/RNA
Keywords: catalytic RNA, RNA binding protein-RNA complex
Deposited on 2009-12-16, released 2009-12-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-01-21, with a file datestamp of 2015-01-16.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.265
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012 (0-89)
      • conflict (24)
      • conflict (29)
    Domains in SCOPe 2.06: d3l3ca_
  • Chain 'B':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012 (0-89)
      • conflict (24)
      • conflict (29)
    Domains in SCOPe 2.06: d3l3cb_
  • Chain 'C':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012 (0-89)
      • conflict (24)
      • conflict (29)
    Domains in SCOPe 2.06: d3l3cc_
  • Chain 'D':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012 (0-89)
      • conflict (24)
      • conflict (29)
    Domains in SCOPe 2.06: d3l3cd_
  • Chain 'E':
    Compound: RNA (5'-r(*ap*(a2m)*gp*cp*gp*cp*cp*ap*gp*ap*ap*cp*u)-3')
    Species: synthetic, synthetic
  • Chain 'F':
    Compound: RNA (5'-r(*ap*(a2m)*gp*cp*gp*cp*cp*ap*gp*ap*ap*cp*u)-3')
    Species: synthetic, synthetic
  • Chain 'G':
    Compound: RNA (5'-r(*ap*(a2m)*gp*cp*gp*cp*cp*ap*gp*ap*ap*cp*u)-3')
    Species: synthetic, synthetic
  • Chain 'H':
    Compound: RNA (5'-r(*ap*(a2m)*gp*cp*gp*cp*cp*ap*gp*ap*ap*cp*u)-3')
    Species: synthetic, synthetic
  • Chain 'P':
    Compound: glms ribozyme
    Species: synthetic, synthetic
  • Chain 'Q':
    Compound: glms ribozyme
    Species: synthetic, synthetic
  • Chain 'R':
    Compound: glms ribozyme
    Species: synthetic, synthetic
  • Chain 'S':
    Compound: glms ribozyme
    Species: synthetic, synthetic
  • Heterogens: MG, G6P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l3cA (A:)
    rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
    nalrsmqgfpfydkpmriqyaktdsdiiak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l3cB (B:)
    rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
    nalrsmqgfpfydkpmriqyaktdsdiiak
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l3cC (C:)
    rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
    nalrsmqgfpfydkpmriqyaktdsdiiak
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l3cD (D:)
    rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
    nalrsmqgfpfydkpmriqyaktdsdiiak
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.