PDB entry 3l33

View 3l33 on RCSB PDB site
Description: Human mesotrypsin complexed with amyloid precursor protein inhibitor(APPI)
Class: Hydrolase/Cell Adhesion
Keywords: Human mesotrypsin, alzheimer's amyloid precursor protein inhibitor, APPI, Serine protease inhibitor, Hydrolase-Cell Adhesion complex
Deposited on 2009-12-16, released 2010-09-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-01-12, with a file datestamp of 2011-01-07.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: 0.198
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: PRSS3, PRSS4, TRY3, TRY4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35030 (0-223)
      • variant (107)
      • engineered mutation (176)
    Domains in SCOPe 2.06: d3l33a_
  • Chain 'B':
    Compound: Trypsin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: PRSS3, PRSS4, TRY3, TRY4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35030 (0-223)
      • variant (107)
      • engineered mutation (176)
    Domains in SCOPe 2.06: d3l33b_
  • Chain 'C':
    Compound: Trypsin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: PRSS3, PRSS4, TRY3, TRY4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35030 (0-223)
      • variant (107)
      • engineered mutation (176)
    Domains in SCOPe 2.06: d3l33c_
  • Chain 'D':
    Compound: Trypsin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: PRSS3, PRSS4, TRY3, TRY4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35030 (0-223)
      • variant (107)
      • engineered mutation (176)
    Domains in SCOPe 2.06: d3l33d_
  • Chain 'E':
    Compound: amyloid beta a4 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: APP, A4, AD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3l33e_
  • Chain 'F':
    Compound: amyloid beta a4 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: APP, A4, AD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3l33f_
  • Chain 'G':
    Compound: amyloid beta a4 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: APP, A4, AD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3l33g_
  • Chain 'H':
    Compound: amyloid beta a4 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: APP, A4, AD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3l33h_
  • Heterogens: FMT, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l33A (A:)
    ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
    neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
    wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp
    vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l33B (B:)
    ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
    neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
    wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp
    vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l33C (C:)
    ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
    neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
    wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp
    vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l33D (D:)
    ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
    neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
    wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp
    vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l33E (E:)
    vcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavc
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l33F (F:)
    vcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavc
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l33G (G:)
    vcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavc
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l33H (H:)
    vcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavc