PDB entry 3l2y

View 3l2y on RCSB PDB site
Description: The structure of C-reactive protein bound to phosphoethanolamine
Class: Calcium-BINDING PROTEIN
Keywords: PENTRAXIN, ACUTE PHASE REACTANT, IMMUNE SYSTEM, PHOSPHOETHANOLAMINE, Acute phase, Metal-binding, Pyrrolidone carboxylic acid, Secreted, Calcium-BINDING PROTEIN
Deposited on 2009-12-15, released 2010-12-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-03-23, with a file datestamp of 2011-03-18.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.225
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c-reactive protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3l2ya_
  • Chain 'B':
    Compound: c-reactive protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3l2yb_
  • Chain 'C':
    Compound: c-reactive protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3l2yc_
  • Chain 'D':
    Compound: c-reactive protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3l2yd_
  • Chain 'E':
    Compound: c-reactive protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3l2ye_
  • Chain 'F':
    Compound: c-reactive protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3l2yf_
  • Chain 'G':
    Compound: c-reactive protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3l2yg_
  • Chain 'H':
    Compound: c-reactive protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3l2yh_
  • Chain 'I':
    Compound: c-reactive protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3l2yi_
  • Chain 'J':
    Compound: c-reactive protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3l2yj_
  • Chain 'K':
    Compound: c-reactive protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3l2yk_
  • Chain 'L':
    Compound: c-reactive protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3l2yl_
  • Chain 'M':
    Compound: c-reactive protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3l2ym_
  • Chain 'N':
    Compound: c-reactive protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3l2yn_
  • Chain 'O':
    Compound: c-reactive protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3l2yo_
  • Chain 'P':
    Compound: c-reactive protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3l2yp_
  • Chain 'Q':
    Compound: c-reactive protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3l2yq_
  • Chain 'R':
    Compound: c-reactive protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3l2yr_
  • Chain 'S':
    Compound: c-reactive protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3l2ys_
  • Chain 'T':
    Compound: c-reactive protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3l2yt_
  • Heterogens: CA, OPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l2yA (A:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l2yB (B:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l2yC (C:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l2yD (D:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l2yE (E:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l2yF (F:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l2yG (G:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l2yH (H:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l2yI (I:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l2yJ (J:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l2yK (K:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l2yL (L:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l2yM (M:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l2yN (N:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l2yO (O:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l2yP (P:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l2yQ (Q:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l2yR (R:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l2yS (S:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l2yT (T:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp