PDB entry 3l2o

View 3l2o on RCSB PDB site
Description: Structure-Based Mechanism of Dimerization-Dependent Ubiquitination by the SCFFbx4 Ubiquitin Ligase
Class: protein binding/cell cycle
Keywords: small G protein fold, Ubl conjugation pathway, ubiquitin protein ligase, PROTEIN BINDING-CELL CYCLE complex
Deposited on 2009-12-15, released 2010-02-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.252
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S-phase kinase-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EMC19, OCP2, SKP1, SKP1A, TCEB1L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63208
      • engineered (1)
      • insertion (63-66)
    Domains in SCOPe 2.08: d3l2oa1
  • Chain 'B':
    Compound: F-box only protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: FBX4, FBXO4
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l2oA (A:)
    masiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhk
    ddpggsgtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpee
    irktfnikndfteeeeaqvrkenqwceek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2oA (A:)
    asiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
    dpggsgtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeei
    rktfnikndfteeeeaqvrkenqwc
    

  • Chain 'B':
    No sequence available.